TMIGD2/CD28H Fc Chimera Protein, Human
SKU: 1529982199

TMIGD2/CD28H Fc Chimera Protein, Human

Sale price$270.00 Regular price$300.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 8 - Jul 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

TMIGD2/CD28H Fc Chimera Protein, HumanProduct Specification Species Human Accession Q96BF3 Amino Acid Sequence Leu23 Gly150, with C terminal Human IgG1 Fc

Product Specification


Species Human
Accession Q96BF3
Amino Acid Sequence

Leu23-Gly150, with C-terminal Human IgG1 Fc LSVQQGPNLLQVRQGSQATLVCQVDQATAWERLRVKWTKDGAILCQPYITNGSLSLGVCGPQGRLSWQAPSHLTLQLDPVSLNHSGAYVCWAAVEIPELEEAEGNITRLFVDPDDPTQNRNRIASFPGIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 49-64kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Transmembrane and immunoglobulin domain containing 2 (TMIGD2)is new a immune checkpoint molecule of the B7:CD28 family which is a novel cell adhesion receptor that is expressed in various human organs and tissues, mainly in cells with epithelium and endothelium origins. TMIGD2 regulates cellular morphology, homophilic cell aggregation, and cell-cell interaction. TMIGD2 activity also modulates actin stress fiber formation and focal adhesion and reduces cell migration. Silencing of expression of TMIGD2 by small interfering RNA (siRNA) and by ectopic overexpression in endothelial cells showed that TMIGD2 regulates capillary tube formation in vitro, and B16F melanoma cells engineered to express TMIGD2 displayed extensive angiogenesis in the mouse Matrigel angiogenesis model. Moreover, TMIGD2, through its proline-rich cytoplasmic domain, associates with multiple Src homology 3 (SH3)-containing signaling proteins, including SH3 protein interacting with Nck (SPIN90/WISH), bullous pemphigoid antigen-1, and calcium channel β2.Silencing of expression of SPIN90/WISH by siRNA in endothelial cells showed that SPIN90/WISH is required for capillary tube formation. These features of TMIGD2 suggest that TMIGD2 is a novel receptor that plays an important role in cell-cell interaction, cell migration, and angiogenesis. 

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 1529982199

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 916 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
Sean
Charlottesville, US
★★★★★ 4
Fun, both heartwarming and heartbreaking
Format: Kindle
Only my second first person written selection, I am still getting used to that aspect, but unlike my first, I enjoyed that the story was told through both MCs. A great enemies to lovers, forced proximity, fated love etc, that resonated to me. There were some small twists that I could see coming, but also a few that I didn’t quite see until the characters were also seeing. Personally, I am more interested in the story than the spice, but with that said, it was well seasoned! I am kind of new to the spice world so I can’t say for sure how this would rate, but it definitely had some heat. I am very glad I happened across this author, and I do plan on also reading the next book….if nothing else, just to see for myself the “transformation” of the characters I’ve grown to love!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2024
H
Verified Purchase
Havinne Akins
Pawtucket, US
★★★★★ 5
😍😍 BEST DEBUT NOVEL EVER
Format: Paperback
I’m having trouble finding accurate words to describe the way this book made me feel, but I am going to do my best. To start off with basic elements, the character and world building are phenomenal. I feel a strong bond to not only the two main characters, Ara and Rogue, but to each and every character introduced throughout the book. The author did a stellar job of giving each of them unique personhood. All of the scenes are beautifully described. So much so that throughout the entirety of the book, I could see every scene: the towns, the castles, the meadows, the landscape. I have had difficulty with this and with distinguishing between outlying characters while reading in the past, but I did not have to think to remember details of world or character building because they flowed naturally within the story and were described well. I have read book series before that made me want to be a part of that world, but I actually felt like I got to step into Auryna and Ravaryn! The plot twists!! Although this is not a suspense novel, it still had me on a rollercoaster of emotions and on the edge of my seat from beginning to end. I haven’t cried actual tears over a book since I was in high school (and I’ve read a LOT). This book finally broke the floodgates in the final few chapters. Multiple times. And we love a good cliffhanger. It truly made me FEEL. THE SPICE is a solid 3.5/5. Some of the scenes had me flushed, some had me taking notes, some just had my jaw slack and my mouth hanging open. Bravo, JD Linton, bravo. The relationships: friendships, family, romantic, ALL of the relationships in this book have so much meaning. The author does a great job at making you feel the love, the anger, the peace, the frustrations, the safety, the familiarity, etc. between the characters. Ara and Rogue. I can not say enough and I also do not want to say too much. Just know that I feel like I know them both, to their core. I know what their childhood looks likes, their darkest moments, their biggest fears, their dreams and passions, what they want in life… The POV switches were seamless. I am so happy this author decided to let us see from both sets of eyes. I can not wait for book two after that cliffhanger. And there is SO much potential for at least one prequel, I can’t wait to see where this author goes! I hope this series continues and flourishes. Fingers crossed!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 5, 2022
T
Verified Purchase
Tracy and Christina
San Leandro, US
★★★★★ 5
Amazing!
Format: Kindle, Format: Kindle
This book was phenomenal, I devoured it within a few days! For this being a debut novel, it is fantastic and I would’ve thought the author was a seasoned author. I have zero complaints about this book. Let me start by saying that the world building was phenomenal. I could picture everything in my head because of how detailed it was — that’s how good it was written. And I absolutely love the “captive/captor” trope so much, it’s become one of my favorite tropes, so I was pleasantly surprised to see that this book had that. I loved the banter between Rogue and Ara — they’re both snarky and witty, plus with the romantic tension, it made the dialogue that much better. Speaking of romantic tension, yes there is spice but not so much of it that it overrides the plot, which I loved. For me, this would probably be on the 3/5 level of spice. This book had a ton of plot twists and I thoroughly enjoyed it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 13, 2024
R
Verified Purchase
R Spires
Lexington, US
★★★★★ 4
High on Tropes and Satisfaction
Format: Kindle
This is a great Romantasy book full of action, adventure, and everything you look for in this genre. I won’t lie: it does kinda feel like the author found every common trope from every successful book of this kind and threw them all into this novel. But if it ain’t broke, don’t fix it. Especially in romance, there’s a large audience who has specific expectations, and they want them every time. Nothing wrong with that and many times I’m one of them. I have no idea what defines a spoiler honestly, so spoiler alert!!!!!!! Tropes include: Only one bed at the inn/bar Dissatisfaction with life before hunk appears Lost royalty The chosen one Montage of dress up time followed by shocked hunk Forbidden romance between two from rival peoples Power that cannot be controlled, simply guided/asked Gathering intel at the inn/bar FMC who knows how to fight/use weapons well There’s probably more but no need to list them all. Good story and I would recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 14, 2024
L
Verified Purchase
Lisa B.
Louisville, US
★★★★★ 5
OUTSTANDING
Format: Kindle
This was very, very good. The world is vast and characters are complex. There is a good plot with a whole lot going on. This is well written. Good twists and turns and some heart breaking moments. You will love these characters, they have heart and loyalty. I am hoping that there will be several more books. We've yet to see anything from the Sea Court but only a mention of them here and there. The Wood Court was given a quick couple of scenes, and only as far as some warriors, we've yet to enter their court and the Shadow Court, I'm not sure if they will be a force for good or bad, but they definitely will play a much bigger role moving forward. This is primarily the Ice and Air Courts. Told in multiple views, which I loved, it gives you a chance to see things from different eyes. There's alot of political maneuvering and deception. I loved it and will pick up the next book as it becomes available. If you like The Fae and the courts, you should love this. I think the author has mucn in store for us.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 8, 2020

recommand products