SKU: 16773263622

Human CD3 delta, His tag

Sale price$40.50 Regular price$45.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 11 - Jul 16

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD3 delta, His tagProduct Specification Species Human Synonyms T cell surface glycoprotein CD3 delta chain, T cell receptor T3 delta chain, CD3d Accession P04234 Amino Acid Sequence Protein sequence(P04234, Phe22 Ala105, with C 10*His) FKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 11. 2kDa Actual: 18 25kDa Purity 90% by SDS PAGE Tag with C 10*His Physical

Product Specification


Species Human
Synonyms T-cell surface glycoprotein CD3 delta chain, T-cell receptor T3 delta chain, CD3d
Accession P04234
Amino Acid Sequence

Protein sequence(P04234, Phe22-Ala105, with C-10*His) FKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:11.2kDa Actual:18-25kDa
Purity >90% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CD3 delta is part of the T-cell receptor/CD3 complex (TCR/CD3 complex) and is involved in T-cell development and signal transduction. The encoded membrane protein represents the delta subunit of the CD3 complex, and along with four other CD3 subunits, binds either TCR alpha/beta or TCR gamma/delta to form the TCR/CD3 complex on the surface of T-cells. Defects in this gene are a cause of severe combined immunodeficiency autosomal recessive T-cell-negative/B-cell-positive/NK-cell-positive (SCIDBNK). Two transcript variants encoding different isoforms have been found for this gene.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 16773263622

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 1105 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
G
Verified Purchase
Ger. K
Alexandria, US
★★★★★ 5
Perfect Balance of Comfort & Support!
Color: Soft, Size: Standard(24"×16"×5.5")
I absolutely love this pillow! The Talalay latex feels incredibly supportive while still being soft and comfortable. Unlike memory foam, it doesn't trap heat or give off any chemical smell-just clean, natural comfort. I've noticed a huge difference in my sleep quality; it relieves pressure from my neck and shoulders, and I wake up without stiffness. The Tencel cover is smooth, breathable, and removable for easy washing, which makes it feel extra fresh. The packaging was beautiful, making it feel like a premium gift right out of the box. If you're looking for a high-quality natural pillow that's supportive, durable, and chemical-free, this is it. Highly recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 31, 2025
J
Verified Purchase
J. K. Brough
Lowell, US
★★★★★ 3
Hard to judge thickness with only dimensions to go by
Color: Soft, Size: Standard(24"×16"×5.5")
Very nice quality, just what I hoped for. But it's just too thick for me. I'm thinking of using my electric knife to try to skim enough off to be usable. I've slept most of my life on latex pillows and have not enjoyed using other pillows.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 3, 2026
A
Verified Purchase
AmazonPrime User
Dallas, US
★★★★★ 4
Good pillow, but too high for my neck
Color: Soft, Size: Standard(24"×16"×5.5")
I love the Talalay latex for the quality, and that there is no smell. However, it is too high for my neck. I wish the company would make it in a 3" version, instead of just 5.5". They do have a "slim" version, but it is not even the same kind of pillow. It measures 2.5" and the back side is completely flat, so you can not turn it in over for use. The company basically took this 5.5" version and cut it in half for the slim.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 7, 2025
L
Verified Purchase
Lais
Cuba, US
★★★★★ 5
The Ultimate Natural Latex Pillow
Color: Soft, Size: Standard(24"×16"×5.5")
I recently switched to the Talatex 100% Natural Premium Latex Pillow and it has transformed my sleep. Unlike synthetic memory foam, this Purefusion Talalay Latex is incredibly supportive yet soft, providing excellent pressure relief for both my neck and shoulders. I appreciate knowing there are no harsh chemicals in the core.  It retains its shape perfectly night after night and stays cool thanks to the breathable material. The quality is immediately apparent, especially with the removable Tencel cover, which is luxuriously smooth. It arrived in a beautiful package, truly making it the best gift for anyone seeking a healthier, more comfortable night's sleep. Highly recommended!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 28, 2025
A
Verified Purchase
Aisha Yousaf
Carnegie, US
★★★★★ 5
The Natural Way to Better Sleep.
Color: Soft, Size: Standard(24"×16"×5.5"), Color: Soft, Size: Standard(24"×16"×5.5")
After trying out several latex over the years, the Talatex Talalay 100 stands out for its luxurious comfort, quality materials, and overall sleep experience. Made from 100% natural Talalay latex, it offers a perfect balance of softness and support. Comfort & Support: The Talalay latex feels incredibly buoyant yet plush. I found it especially beneficial for relieving neck pain. Temperature Regulation: One of the best aspects is its breathability. Latex naturally sleeps cooler than other foams. Eco-Friendliness: Another big plus is that it’s made from natural latex with no synthetic additives, making it a healthier and more environmentally friendly choice. It’s also hypoallergenic, which is great for allergy sufferers. Verdict: If you're looking for a premium latex sleep surface that delivers both comfort and longevity, the Talatex Talalay 100 is a solid investment. It’s not the cheapest option out there, but the quality and sleep experience justify the price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 14, 2025

recommand products