Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 12 - Jul 17
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Apolipoprotein A-I/APOA1 His Tag Protein, HumanProduct Specification Species Human Synonyms Apolipoprotein A I, Apo AI, ApoA I, Apolipoprotein A1, APOA1; Apolipoprotein A I, Apo AI, ApoA I, Apolipoprotein A1, APOA1 Accession P02647 Amino Acid Sequence Asp25 Gln267, with N 6*His
Product Specification
| Species | Human |
| Synonyms | Apolipoprotein A-I, Apo-AI, ApoA-I, Apolipoprotein A1, APOA1;Apolipoprotein A-I, Apo-AI, ApoA-I, Apolipoprotein A1, APOA1 |
| Accession | P02647 |
| Amino Acid Sequence | Asp25-Gln267, with N-6*His MHHHHHHDDDDKDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ. |
| Expression System | E.coli |
| Molecular Weight | 29.6 kDa |
| Purity | ＞98% by SDS-PAGE and RP-HPLC |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | 20mM Tris-HCl, 100mM NaCl, pH8.0 |
| Reconstitution | Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation . |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
Background
Apolipoprotein A-I/APOA1 mainly exists in high density lipoprotein (HDL) particles, which can prevent excessive accumulation of cholesterol in macrophages, form foam cells, deposit on the arterial wall, and cause atherosclerosis. The main function of APOA1 is to activate lecithin cholesterol acyltransferase (LCAT) in HDL complex, catalyze cholesterol esterification, and then dissolve more cholesterol-HDL complex, increase the cholesterol transport capacity of HDL particles and the ability of liver to metabolize cholesterol. Therefore, APOA1 is an important marker to evaluate the ability of blood cholesterol clearance.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.7 ★★★★★
Based on 2136 reviews
Sort
Product Reviews
★★★★★ 4
doesn't whistle as loud as other chuckit balls I've seen, but a good ball.
makes some noise, but I've seen (and played with) others at the dog park that whistle much louder than the 1 I got. all Chuckit balls... so, just this one I'm betting.
but it flys good and the dog loves to chase it.
he chews it a fair bit as well and the ball has not taken much damage from him (lab mix) or others that have had a go at it.
I'll likely buy another at some point ... just wish it was a little louder when flying.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 4, 2025
★★★★★ 5
Blue ball, my dog likes blue.
Just a ball right? Evidently not! My dog won’t chase an orange chuck it ball or the glow in the dark ball- only the blue one 🤷🏼♀️
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 9, 2025
★★★★★ 3
I wanted a blue ball
It's great. It just wasn't blue.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 5, 2026
★★★★★ 5
its a great ball
works well
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 8, 2025
★★★★★ 5
Love this set!!!
Size: Medium (2.5"), Style: Fetch Pack 1
I was trying to figure out which of the many different balls this company offers, and I was getting frustrated but then i was SOOOO happy to see they had multiple sets that had multiple of the different balls they offer!! I bought this set and the other set they offer, but this one was my favorite and I think my dogs too! The orange ball works great and bounces just high enough that it doesn’t clear our patio wall, but enough for him to go and jump up to retrieve. But the glow in the dark ball is his favorite! Both me and my pomsky were blown away how we brought the glow in the dark ball outside just as the sun was going down, and when we brought it back inside it was BRIGHT AND GLOWY!!! Even with the sun going down and not much light left!! He loves to play with it in the house after it’s all glowy from the sun. Sometimes we even glow it up under a light inside the house if it’s dark outside, and he will play with it outside in the dark haha he loves it!!! And I think it’s pretty cool too!! All of the balls this company overs are VERY durable! We realized early on that we cannot give our dog regular tennis balls cuz his favorite thing to do is tear the outside fabric off!! So we were trying to figure out what company has the best balls for dogs so they can’t sit there and try to pry them apart, and we found this company!! We have already bought from them about 3 times and all of their balls are durable and bounce how they say they will bounce!! They have the super bouncers and the glow in the dark one and the one with angles that will bounce in different directions and the ones you can throw REALLYY far! Overall, all the balls from this company are very durable, bounce really good, and keep my dog occupied without allowing him to sit there and tear it apart!!! Which i love cuz I do not like when he stops playing with us to sit there and try to take off the fabric, cuz then he could swallow it! So always buy the balls from this company!!! They are the best and most durable!!!! Also plenty soft for your dogs mouth so they can chew on it a bit and it won’t hurt their teeth/gums!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 28, 2024