Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 12 - Jul 17
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Axl His Tag Protein, MouseProduct Specification Species Mouse Synonyms Axl, UFO, Tyro7, JTK11, ARK Accession Q00993 Amino Acid Sequence His20 Pro443, with C terminal 10*His
Product Specification
| Species | Mouse |
| Synonyms | Axl, UFO, Tyro7, JTK11, ARK |
| Accession | Q00993 |
| Amino Acid Sequence | His20-Pro443, with C-terminal 10*His HKDTQTEAGSPFVGNPGNITGARGLTGTLRCELQVQGEPPEVVWLRDGQILELADNTQTQVPLGEDWQDEWKVVSQLRISALQLSDAGEYQCMVHLEGRTFVSQPGFVGLEGLPYFLEEPEDKAVPANTPFNLSCQAQGPPEPVTLLWLQDAVPLAPVTGHSSQHSLQTPGLNKTSSFSCEAHNAKGVTTSRTATITVLPQRPHHLHVVSRQPTELEVAWTPGLSGIYPLTHCNLQAVLSDDGVGIWLGKSDPPEDPLTLQVSVPPHQLRLEKLLPHTPYHIRISCSSSQGPSPWTHWLPVETTEGVPLGPPENVSAMRNGSQVLVRWQEPRVPLQGTLLGYRLAYRGQDTPEVLMDIGLTREVTLELRGDRPVANLTVSVTAYTSAGDGPWSLPVPLEPWRPGQGQPLHHLVSEPPPRAFSWPGGGSGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 60-78kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference |
1、Weinger J G. et al. (2011) Loss of the receptor tyrosine kinase Axl leads to enhanced inflammation in the CNS and delayed removal of myelin debris during Experimental Autoimmune Encephalomyelitis. J Neuroinflammation. 8: 49. 2、Linger R M. et al. (2010) Taking aim at Mer and Axl receptor tyrosine kinases as novel therapeutic targets in solid tumors. Expert Opin Ther Targets. 14(10): 1073-1090. 3、Cavet M E. et al. (2010) Gas6-Axl pathway: the role of redox-dependent association of Axl with nonmuscle myosin IIB. Hypertension. 56(1): 105-111. 4、Rankin E B. et al. (2010) AXL is an essential factor and therapeutic target for metastatic ovarian cancer. Cancer Res. 70(19): 7570-7579. |
Background
AXL Receptor Tyrosine Kinase is also known as Tyrosine-protein kinase receptor UFO, which belongs to the protein kinase superfamily, Tyr protein kinase family and AXL/UFO subfamily. Mature human Axl consists of a 426 aa extracellular domain (ECD) that contains two Ig-like domains and two fibronectin type III domains, a 21 aa transmembrane segment, and a 422 aa cytoplasmic domain that includes the tyrosine kinase domain. In the nervous system, Axl and its ligand Growth-arrest-specific protein 6 (Gas6) are expressed on multiple cell types. Axl functions in dampening the immune response, regulating cytokine secretion, clearing apoptotic cells and debris, and maintaining cell survival. Axl is upregulated in various disease states, such as in the cuprizone toxicity-induced model of demyelination and in multiple sclerosis (MS) lesions, suggesting that it plays a role in disease pathogenesis. The receptor tyrosine kinase (RTK) AXL has been associated with poor prognosis in numerous malignancies and the emergence of therapy resistance. Upon binding to its ligand GAS6, AXL regulates cell signaling cascades and cellular communication between various components of the tumor microenvironment, including cancer cells, endothelial cells, and immune cells. Converging evidence points to AXL as an attractive molecular target to overcome therapy resistance and immunosuppression, supported by the potential of AXL inhibitors to improve ICI efficacy. Axl contributes to cell survival, migration, invasion, metastasis and chemosensitivity justify further investigation of Axl as novel therapeutic targets in cancer. The soluble AXL receptor as a therapeutic candidate agent for treatment of metastatic ovarian cancer.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.4 ★★★★★
Based on 420 reviews
Sort
Product Reviews
★★★★★ 5
Best flip-flops I've met
Size: 11, Color: Black/Geyser
Right away I was impressed by the thichness and cushioning of these flip-flops. They are not a flimsy piece of rubber under my foot. The sole is more like that of an athletic shoe with layers and an impressive tread.
I've always found that my heel sits too much on the back edge of flip-flops, or even over it. So I ordered these just a half size large and they're perfect. The foot cradling allows my heel to sit down inside the flip-flop comfortably and securely. They're not about to fall off. The toe piece (I don't know what it's actually called) is not just the typical round rubber post. On these flip-flops it's nicely shaped and fits comfortably between my toes.
The arch support is nice too. They're not just flat.
In spite of being more substantial than the cheapies we all know, these remain lightweight. They clearly look better too
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 28, 2026
★★★★★ 5
Well made
Size: 11, Color: Black/Geyser
The first thing that stands out about the Columbia PFG Castback Flip sandals is the solid build and clean fishing-inspired design. The Black/Geyser color combination looks sharp and matches the product photos well. The straps feel durable and comfortable against the foot, and the footbed has a slightly cushioned feel that makes them comfortable right out of the box. Overall construction feels sturdy, which is what you’d expect from something designed for outdoor or water use.
In everyday wear, the sandals are comfortable and easy to walk in. The footbed provides decent grip and support, and the textured surface helps keep your foot from sliding around when they get wet. They work well for casual use, whether it’s around the house, at the beach, or after a day on the water. The lightweight feel also makes them easy to pack for trips or outdoor activities.
After wearing them for a while, they hold up well and remain comfortable for daily use. The materials seem durable and the straps stay secure without stretching out. They’re simple, reliable sandals that work well for warm weather, boating, or casual summer wear. Overall, they’re a solid choice for anyone looking for comfortable flip flops with a slightly more rugged outdoor style.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 10, 2026
★★★★★ 5
Extremely comfortable with slight roomy fit
Size: 11, Color: Black/Geyser, Size: 11, Color: Black/Geyser
These are easily the most comfortable flip flops I have ever owned. From the moment I put them on, there was no break in period at all. They felt soft, supportive, and ready for all day wear right out of the box.
The cushioning is excellent without feeling too soft, and they have a nice stable feel when walking. They are lightweight and clearly made with quality materials, making them great for everyday use or around water.
One thing to note is that they run a little on the larger side, so if you are between sizes, you may want to consider sizing down for a better fit.
Overall, these are a great combination of comfort, durability, and function. I would absolutely recommend them, especially if comfort is your top priority. (Excuse the teeth marks- my dog unfortunately got ahold of them before I snapped the photo- they are PERFECT out of the box)
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 22, 2026
★★★★★ 5
Comfortable Flip-Flops with a Clean, Sporty Look
Size: 13, Color: Black/Geyser
I picked up the Columbia Men’s PFG Castback Flip in the black and white colorway, and the first thing I noticed was how comfortable they felt right out of the box.
How They’ve Been Used:
Even though it’s still winter, I’ve been wearing them around the house occasionally to get a feel for the fit and comfort. I plan to use them more regularly outdoors once the weather warms up.
What Worked Well:
Immediate Comfort: The footbed feels cushioned and supportive without needing a break-in period.
Secure Fit: The straps sit comfortably without rubbing or feeling stiff.
Lightweight Design: Easy to slip on and off for quick wear.
Clean Style: The black and white combination gives them a sharp, versatile look.
Positive Feedback: My wife has already commented on how good they look.
Things to Keep in Mind:
Seasonal Use: Best suited for warmer weather and casual settings.
Sizing: Checking the size guide helps ensure the right fit.
Bottom Line:
Based on my experience so far, these flip-flops offer a great balance of comfort and style. They’re comfortable enough for everyday wear and look sharp enough for casual outings. I’m looking forward to putting them to full use once spring arrives.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 27, 2026
★★★★★ 5
Columbia always makes great stuff
Size: 14, Color: Espresso II/Black
Even with my flat feet these offer a lot of padding which makes these extremely comfortable. They increase my height about an inch haha. These are great for walking around the beach or just going for walks. The tread on the bottom of these make walking up hills where the surfaces are not completely even extremely easy and very grippy. Time will tell how durable these are, but so far they're holding up very well.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 15, 2026