SLAMF7/CRACC/CD319 Fc Chimera Protein, Human
SKU: 33953486449

SLAMF7/CRACC/CD319 Fc Chimera Protein, Human

Sale price$225.00 Regular price$250.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 8 - Jul 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

SLAMF7/CRACC/CD319 Fc Chimera Protein, HumanProduct Specification Species Human Synonyms SLAMF7, CRACC, CD319, CS1, CRACC, 19A, FOAP 12 Accession Q9NQ25 Amino Acid Sequence Ser23 Met226, with C terminal Human IgG1 Fc

Product Specification


Species Human
Synonyms SLAMF7, CRACC, CD319, CS1, CRACC, 19A, FOAP-12
Accession Q9NQ25
Amino Acid Sequence

Ser23-Met226, with C-terminal Human IgG1 Fc SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSMIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight

60-72kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer

PBS, pH7.4

Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Reference

1、Lee J K. et al. (2004) Molecular and functional characterization of a CS1 (CRACC) splice variant expressed in human NK cells that does not contain immunoreceptor tyrosine-based switch motifs. Eur J Immunol. 34(10): 2791-2799.

2、Tassi I. et al. (2005) The cytotoxicity receptor CRACC (CS-1) recruits EAT-2 and activates the PI3K and phospholipase Cgamma signaling pathways in human NK cells. J Immunol. 175(12): 7996-8002.

3、Lee J K. et al. (2007) CS1 (CRACC, CD319) induces proliferation and autocrine cytokine expression on human B lymphocytes. J Immunol. 179(7): 4672-4678.

4、Cruz-Munoz M E. et al. (2009) Influence of CRACC, a SLAM family receptor coupled to the adaptor EAT-2, on natural killer cell function. Nat Immunol. 10(3): 297-305.

Background

SLAM family member 7 (SLAMF7) is also known as CD2-like receptor-activating cytotoxic cells (CRACC), Membrane protein FOAP-12, CD antigen CD319, Novel Ly9, Protein 19A, which is a single-pass type I membrane protein and a member of the CD2 family of cell surface receptors. Mature mouse CRACC consists of a 202 amino acid (aa) extracellular domain (ECD) with one Ig-like V-set domain and one Ig-like C2-set domain, a 21 aa transmembrane segment, and an 88 aa cytoplasmic domain with two immunoreceptor tyrosine-based switch motifs ITSMs. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and thus are involved in the regulation and interconnection of both innate and adaptive immune response. Activities are controlled by presence or absence of small cytoplasmic adapter proteins, SH2D1A/SAP and/or SH2D1B/EAT-2. Mediates natural killer (NK) cell activation through a SH2D1A-independent extracellular signal-regulated ERK-mediated pathway. Positively regulates NK cell functions by a mechanism dependent on the adapter SH2D1B. In addition to heterotypic NK cells-target cells interactions also homotypic interactions between NK cells may contribute to activation. However, in the absence of SH2D1B, inhibits NK cell function.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 33953486449

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 1604 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Mal
Natrona Heights, US
★★★★★ 5
Exactly what I needed!
Color: Black
Perfect to organize my jewellery while I travel
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 28, 2026
T
Verified Purchase
Tiana
Phoenix, US
★★★★★ 5
It works so far lol!
Color: Apricotpink, Color: Apricotpink
I like it! I just packed it up with jewelry so when I travel with it (soon) I will update but my necklaces aren't snagging on each other so hopefully it travels well. It looks as good as it does in the pics and packs like a mini suitcase. It does get bulky, but that's because some of my jewelry is big and bulky so if you have flat jewelry it will lay down. I will have it on top so it doesn't get crushed, and will see if it travels well. It looks good and closes so we will see 🤞🏽!!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026
A
Amber S
Charlottesville, US
★★★★★ 4
Spacious and Well-Organized, Just a Bit Bulky for Travel
This jewelry organizer has tons of space and keeps everything neatly separated and easy to find. I love the binder-style layout and the zippered pouch for smaller pieces—it’s super functional and well thought out. The quality feels solid, and it holds a lot without tangling. My only drawback is that it’s a bit too large for convenient travel, especially if you’re trying to pack light. Still, a great option for home storage or longer trips where space isn’t as tight.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 14, 2026
A
Verified Purchase
AmazingLEEstyled
West Palm Beach, US
★★★★★ 5
Good quality
Color: Beige
Mom bought it for herself and absolutely loves it
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 30, 2026
K
Verified Purchase
ken
Lake Worth, US
★★★★★ 5
On the go jewelry case
Color: Apricotpink
Great for taking my jewelry on trips
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026

recommand products