SKU: 35152705855

Human Geminin , His tag

Sale price$90.00 Regular price$100.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 13 - Jul 18

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Geminin , His tagProduct Specification Species Human Synonyms GMNN Accession O75496 Amino Acid Sequence Protein sequence(O75496, Leu110 Ile209, with C 10*His) MLYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCIGGGGSHHHHHHHHHH Expression System E. coli Molecular Weight Theoretical: 13. 1kDa Actual: 19kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer Lyophilized

Product Specification


Species Human
Synonyms GMNN
Accession O75496
Amino Acid Sequence

Protein sequence(O75496, Leu110-Ile209, with C-10*His)
MLYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCIGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Theoretical:13.1kDa Actual:19kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Geminin is a nuclear protein present in most eukaryotes and highly conserved across species, numerous functions have been elucidated for geminin including roles in metazoan cell cycle, cellular proliferation, cell lineage commitment, and neural differentiation. One example of its function is the inhibition of Cdt1. Geminin has been found to be overexpressed in several malignancies and cancer cell lines, while there is data demonstrating that geminin acts as a tumor suppressor by safeguarding genome stability.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 35152705855

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 969 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Cassandra Allen
San Leandro, US
★★★★★ 5
Wonderful tool
Wonderful tool and works great
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 9, 2025
M
Verified Purchase
Mike M
Belleville, US
★★★★★ 5
Nice upgrade 51mm for me
Color: Silver
This is my second 51mm machine. I never used the included handle or basket… I kept my existing HUGH IMS precision basket and bottomless portafilter. The temp and preinfusion are set and not adjustable but fine (reduced variables). I defeated the shut off by volume by setting higher than needed (wish that was easier to turn off). I like to manually shut off when I hit 30g on my scale. The machine will drip since there is not solenoid valve so I just pull the scale from the try when mouse tail breaks and drip starts. The steam wand and hot water dispenser is a massive upgrade (from Capresso EC50) and the real reason for my upgrade. I would have paid $50-100 more for the improvements listed… but I guess most people would not so this is about the best option for me with 51mm (keeping all the 51mm three lug portafilter stuff I own). 5 stars = for me and the price
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 18, 2026
A
Verified Purchase
angelo gaz
Dallas, US
★★★★★ 5
Reliably makes a good cup of coffee!
Color: Rose Golden, Color: Rose Golden
This espresso machine is great. I wanted something simple and reliable and that’s exactly what it is. In fact, the espresso comes out with a nice creamy coffee froth on top and the flavor is excellent. I don’t normally write reviews, but I think this one is worth it and I want them to stay in business because I’ll probably be sending some of these out as gifts come next Christmas.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 1, 2026
W
Verified Purchase
walter Gmuer
Belleville, US
★★★★★ 4
Easy to use
Color: Silver
Easy to use compact and easy to set up pulls some great espresso shots
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 24, 2026
C
Verified Purchase
Caroline Stephany
Whiting, US
★★★★★ 5
Authentic
Color: Black, Color: Black
This machine is amazing. We just returned from Italy and this is as close to a cafe as you can get. It leaves a dense foam on top from the high pressure water system making truly authentic. It is easy to use and clean!! I loved the size too as it fits perfectly on our shelf. Highly recommend if you want an italian cafe to enjoy!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 4, 2026

recommand products