SKU: 4376509055

Human NF-H(Neurofilament heavy polypeptide) , His tag

Sale price$90.00 Regular price$100.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 12 - Jul 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human NF-H(Neurofilament heavy polypeptide) , His tagProduct Specification Species Human Synonyms 200 kDa neurofilament protein; Neurofilament triplet H protein; NEFH; KIAA0845; NFH Accession P12036 Amino Acid Sequence Protein sequence(P12036, Met1 Gln100, with C 10*His) MMSFGGADALLGAPFAPLHGGGSLHYALARKGGAGGTRSAAGSSSGFHSWTRTSVSSVSASPSRFRGAGAASSTDSLDTLSNGPEGCMVAVATSRSEKEQGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 11. 5kDa Actual: 11 30kDa Purity 95% by SDS PAGE Endotoxin <1EU g

Product Specification


Species Human
Synonyms 200 kDa neurofilament protein; Neurofilament triplet H protein; NEFH; KIAA0845; NFH
Accession P12036
Amino Acid Sequence

Protein sequence(P12036, Met1-Gln100, with C-10*His)
MMSFGGADALLGAPFAPLHGGGSLHYALARKGGAGGTRSAAGSSSGFHSWTRTSVSSVSASPSRFRGAGAASSTDSLDTLSNGPEGCMVAVATSRSEKEQGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:11.5kDa Actual:11-30kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Neurofilament, heavy polypeptide (NEFH) is a protein that in humans is encoded by the NEFH gene.It is the gene for a heavy protein subunit that is combined with medium and light subunits to make neurofilaments, which form the framework for nerve cells.Mutations in the NEFH gene are associated with Charcot-Marie-Tooth disease. Neurofilament heavy (NEFH) is one of the critical proteins required for the formation of the neuronal cytoskeleton and polymorphisms in NEFH are reported as a rare cause of sporadic ALS (sALS).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 4376509055

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 173 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
Linda B. Williamson
Draper, US
★★★★★ 5
Great sunscreen
Size: 6.7 Fl Oz (Pack of 1)
Great sunscreen product.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2026
T
Verified Purchase
Thomas E
New York, US
★★★★★ 5
Tan lines
Size: 6.7 Fl Oz (Pack of 1)
This sunscreen works great. It’s light and doesn’t feel greasy on your skin. I use it all the time.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 22, 2026
K
Verified Purchase
Kim
Birmingham, US
★★★★★ 5
Amazing Sunscreen! Large Bottle and Pump is Great!
Size: 12 Fl Oz (Pack of 1), Style: Sport Lotion SPF 50, Size: 12 Fl Oz (Pack of 1), Style: Sport Lotion SPF 50
I’ve been buying this Banana Boat sunscreen with SPF50 for a while and I wish I found it years ago because it makes putting on sunscreen so easy. Been buying it for family members as well! The pump is amazing—I keep one in my bathroom and one in my bedroom so I never forget. It’s a really big bottle so it lasts a long time, and it spreads super easily with no white cast at all, even on my face. The scent is really light and neutral too, which I love. It just melts into your skin, doesn’t feel sticky, and works for everything—face, hands, arms, legs. It’s one of those products you actually end up using every day because it’s so easy and convenient. I keep repurchasing it for a reason! Highly recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 6, 2026
G
Verified Purchase
Glory Mendoza
Phoenix, US
★★★★★ 5
My AmazonFinds/ SPF 50 Sunscreen
Size: 12 Fl Oz (Pack of 1), Style: Sport Lotion SPF 50, Size: 12 Fl Oz (Pack of 1), Style: Sport Lotion SPF 50
I’ve been using this Banana Boat Sport SPF 50 sunscreen and I really like it. It goes on smoothly and absorbs quickly without feeling too greasy or heavy on the skin. I also like that it’s water and sweat resistant, which makes it perfect for outdoor activities or beach days. It provides strong sun protection and I feel confident using it when I’m out in the sun for long periods. The scent is light and not overpowering. Overall, it’s a reliable sunscreen that I would definitely buy again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
D
Verified Purchase
D. Henderson
Grantham, US
★★★★★ 5
Very good sunscreen, advice from a pale-skinned person
Size: 12 Fl Oz (Pack of 1), Style: Sport Lotion SPF 50
I'm Scottish by descent, and so is my skin. This stuff works well, is pleasant, not greasy and seems to hang on despite kiteboarding, surfing, cycling, whatever. Pleasant smell, good dispenser.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026

recommand products