SKU: 50470267750

Human MUC5AC , His tag

Sale price$90.00 Regular price$100.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 12 - Jul 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human MUC5AC , His tagProduct Specification Species Human Synonyms Gastric mucin, Major airway glycoprotein, Mucin 5 subtype AC, tracheobronchial, Tracheobronchial mucin, TBM Accession P98088 Amino Acid Sequence Protein sequence(P98088, Thr1850 Cys1950, with C 10*His) TSTPGSTSSSPAQTTPSTTSKTTETQASGSSAPSSTPGTVSLSTARTTPAPGTATSVKKTFSTPSPPPVPATSTSSMSTTAPGTSVVSSKPTPTEPSTSSCGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 11. 3kDa Actual: 20 120kDa Purity

Product Specification


Species Human
Synonyms Gastric mucin, Major airway glycoprotein, Mucin-5 subtype AC, tracheobronchial, Tracheobronchial mucin, TBM
Accession P98088
Amino Acid Sequence

Protein sequence(P98088, Thr1850-Cys1950, with C-10*His) TSTPGSTSSSPAQTTPSTTSKTTETQASGSSAPSSTPGTVSLSTARTTPAPGTATSVKKTFSTPSPPPVPATSTSSMSTTAPGTSVVSSKPTPTEPSTSSCGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:11.3kDa Actual:20-120kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

MUC-5AC is a large gel-forming glycoprotein. In the respiratory tract it protects against infection by binding to inhaled pathogens that are subsequently removed by mucociliary clearance. Overproduction of MUC-5AC can contribute to diseases such as asthma and chronic obstructive pulmonary disease, and has also been associated with greater protection against influenza infection. This protein has been linked to mucus hypersecretion in the respiratory tract and is associated to chronic obstructive pulmonary disease (COPD).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 50470267750

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 641 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amber
Waukegan, US
★★★★★ 5
Good quality shelves
Size: 23.6 Inch, Color: White, Size: 23.6 Inch, Color: White
Very good quality. Easy to install. Love them in my bathroom.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 18, 2026
S
Verified Purchase
soma
Lake Worth, US
★★★★★ 4
Very spacious and beautiful
Size: 23.6 Inch, Color: White, Size: 23.6 Inch, Color: White
A lot of my books fit on here and there’s still more room left if I wanted to buy more books. It’s a simple looking bookshelf but it’s really pretty. It’s also sturdy the only reason I gave it a 4 stars instead of 5 was because it comes with its own plastic screw anchors and they are crap. The shelves were wobbly when we installed them using the plastic screw anchors that came with the packaging. My dad set mine up and luckily he had a bunch of his own so he switched them out with better screw anchors. Once we made that switch it was perfect, there was no wobble or shaking at all. So that’s my only piece of advice. Besides for the screw anchors everything else is perfect
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 25, 2024
B
Verified Purchase
BWW
Cuba, US
★★★★★ 5
Easy to install
Size: 23.6 Inch, Color: White
Super easy to install. I use different wall anchors. The anchors like all anchors that come with shelves are not great. The shelves look very clean on the wall.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 31, 2026
V
Verified Purchase
Vinnae
Belleville, US
★★★★★ 5
Easy to install
Size: 23.6 Inch, Color: White, Size: 23.6 Inch, Color: White
This product exceeded my expectations. The installation process was incredibly straightforward—even for someone with little to no experience—and the instructions were clear and easy to follow. Once installed, it feels very sturdy and secure, with no wobbling or shifting at all. You can tell it’s well-designed and made with quality materials. I also appreciated how quickly I was able to set everything up without needing any extra tools or help. Overall, it’s a reliable, user-friendly product that I would absolutely recommend to anyone looking for something dependable and easy to install. Drill is required though.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 30, 2026
M
Verified Purchase
Mac
Draper, US
★★★★★ 5
It holds up weight
Size: 23.6 Inch, Color: White
Nice boards. I will order again
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 4, 2026

recommand products