SKU: 53463324567

CEACAM-1/CD66a His Tag Protein, Cynomolgus

Sale price$243.00 Regular price$270.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 12 - Jul 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CEACAM-1/CD66a His Tag Protein, CynomolgusProduct Specification Species Cynomolgus Synonyms CEACAM1, CD66a, BGP, BGP1, BGPI Accession XP_005589426. 2 Amino Acid Sequence Gln35 Gly428, with C terminal 8*His

Product Specification


Species Cynomolgus
Synonyms CEACAM1, CD66a, BGP, BGP1, BGPI
Accession XP_005589426.2
Amino Acid Sequence Gln35-Gly428, with C-terminal 8*His QLTIESRPFNVAEGKEVLLLAHNLSQNLIGYNWHKGERVDAKRLIVAYVIETKQTTPGPAHSGREMIYSNASLLIQNVTQNDTGSYTLQVIKGDLVNEEATGQFRVYPELPKPNITINNSNPVEDKDVVTFTCESEAQDTTYLWWVNNQSLPVSSRLQLSNGNKTLTLLSVLRNDTGPYECEIQNPVSANRSDPVTLNVTYGPDTPTISPSDTYYRPGANLSLSCSAASNPPAQYSWLINETFQQSTQELFIPNITVNNSGSYTCHANNSVTGRNRTTVKMIIVSEQSLVVAQPQIKASKTTVTEDKDYVNLTCSTNDTGISISWFFKDQSLPSSERMKLSQDNATLSINPVKREDAGNYSCEVFNLISKNRSDPIVLIVNYNNPAQENSLPAGGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 65-93kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Tsugawa N. et al. (2021) CEACAM1 specifically suppresses B cell receptor signaling-mediated activation. Biochem Biophys Res Commun. 535: 99-105.

Background

Carcinoembryonic antigen-related cell adhesion molecule 1 (CEACAM1) is a type I transmembrane glycoprotein and a member of the CEA family. The extracellular domain of CEACAM1 consists of a membrane-distal immunoglobulin (Ig)V-like N-region and variable numbers of alternating IgC1- and IgC2-like proximal regions. Therefore, this molecule is also classified as a member of the Ig supergene family. Several heterophilic ligands for the N-domain of CEACAM1 have been reported. However, homophilic ligation of the N-domains of CEACAM1 with another N-domain of CEACAM1 is the predominant means of physiologic interaction. CEACAM1 has been reported to be involved in several functions such as tumor growth, angiogenesis, endocrine function and immunology in humans and rodents.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 53463324567

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 62 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Ashley
Birmingham, US
★★★★★ 4
Portable size to freshen up
Scent: 555 Strawberry + Aire, Size: 1 Fl Oz (Pack of 1)
The fragrance is fruity and light. This is a great size to pop in a purse or gym bag. I also found it easily in my bag because of the bright red color, and my bag is ALWAYS a mess lol. The lid stays on with no issues. Since this is a mist , the scent is there and gone pretty quickly. It doesn’t last long. The price is decent for this brand, but it isn’t going to perform much differently than what you get at the “blue gingham” place. I’ve ordered from Lake & Skye before and I generally like their products.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 28, 2026
R
Rebekah D
San Leandro, US
★★★★★ 5
Fruity body mist
Scent: 555 Strawberry + Aire, Size: 1 Fl Oz (Pack of 1), Scent: 555 Strawberry + Aire, Size: 1 Fl Oz (Pack of 1)
This is a great little travel-size body spray to keep in a beach bag, purse, or suitcase. The spray bottle is compact but still feels sturdy, and it’s super convenient for on-the-go use. The scent is pleasant, sweet, and fruity, and not overpowering at all. To me it has a warm fruity vibe that kind of reminds me of summer days as a kid eating popsicles. Nice for everyday wear if you want something light and easy, plan to reapply every 3 hours or so for maximum scent.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2026
E
Verified Purchase
Elizabeth
Boise, US
★★★★★ 5
Good quality and definitely worth it for energetic dogs.
Color: Orange
The automatic moving and rolling action really grabs my dog’s attention, and the rope adds extra fun for chasing and playing. It helps reduce boredom and keeps my dog mentally stimulated, especially when indoors. The motion activation works well, and it’s a fun and engaging toy overall.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 3, 2026
J
Verified Purchase
Jason Dong
Lexington, US
★★★★★ 5
my dogs love it
Color: Orange
This interactive toy has been a lifesaver for keeping my furry friend occupied. It moves around in unpredictable ways, which really keeps him engaged and guessing. The rope attachment is a nice touch, allowing for a bit of tug-of-war when he's feeling energetic. It's durable enough to withstand his enthusiastic play, which is a huge plus. I've noticed he's less anxious and destructive when I'm not home since he has this to play with. Definitely a great purchase for any dog owner looking to provide some mental stimulation.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 25, 2026
D
Verified Purchase
Douglas J
Birmingham, US
★★★★★ 5
How many dog toys have you bought that just laid on the floor unused?
Color: Orange
New husky has more energy than an entire pre-school - even being walked more than three miles a day wasn’t sufficient to drain her excess energy. I threw the dice on this - and it’s AWESOME. Comes with an extra rope and an extra side piece. Rechargeable with a USB-C cable. When you turn it on, the blue LEDs flash, the entire device buzzes, bounces, and races back and forth across the floor. After a couple of days of uncertainty, my new husky LOVES this. She chases it around, grabs it by the attached rope and carries it from room to room. After a short bit of activity, the toy goes into ‘sleep’ mode, until either the dog touches it again or a timer has elapsed, and then it fires up and starts buzzing and racing around the floor again. From a full charge, the toy will keep your dog entertained all day. Bright orange color makes it much easier to find when it’s rolled behind the toilet (as it did this afternoon). Sturdy. Highly resistant to chew damage. If this one wears out or breaks, I’ll absolutely get another one.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 20, 2026

recommand products