SKU: 54071054747

Human IL-6,His tag

Sale price$166.50 Regular price$185.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 12 - Jul 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-6,His tagProduct Specification Species Human Synonyms B cell stimulatory factor 2 (BSF 2), CTL differentiation factor (CDF), Hybridoma growth factor, Interferon beta 2 (IFN beta 2),IFNB2 Accession P05231 Amino Acid Sequence Protein sequence(P05231, Val30 Met212, with C 10*His)

Product Specification


Species Human
Synonyms B-cell stimulatory factor 2 (BSF-2), CTL differentiation factor (CDF), Hybridoma growth factor, Interferon beta-2 (IFN-beta-2),IFNB2
Accession P05231
Amino Acid Sequence

Protein sequence(P05231, Val30-Met212, with C-10*His)
VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQMGGGGSHHHHHHHHHH

Expression System CHO
Molecular Weight

Theoretical:22.4kDa Actual:20-23kDa

Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Interleukin 6 (IL-6) is an interleukin that acts as both a pro-inflammatory cytokine and an anti-inflammatory myokine. In addition, osteoblasts secrete IL-6 to stimulate osteoclast formation. Smooth muscle cells in the tunica media of many blood vessels also produce IL-6 as a pro-inflammatory cytokine. IL-6's role as an anti-inflammatory myokine is mediated through its inhibitory effects on TNF-alpha and IL-1 and its activation of IL-1ra and IL-10. There is some early evidence that IL-6 can be used as an inflammatory marker for severe COVID-19 infection with poor prognosis, in the context of the wider coronavirus pandemic.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 54071054747

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 970 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
Rachel
Draper, US
★★★★★ 5
great shelves
Style: 4-Tier Shelf Brackets, Hardware Only.
looks so good on a wall, would buy again
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 15, 2026
N
Verified Purchase
nona chambliss
Charlottesville, US
★★★★★ 5
Black iron shelves
Style: 4-Tier Shelf Brackets, Hardware Only.
Love these shelves! Able to put without problems for this 79 yo woman.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 8, 2026
K
Verified Purchase
Ken B.
Omaha, US
★★★★★ 5
Man cave +1
Style: 4-Tier Shelf Brackets, Hardware Only.
Nice add to the man cave
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026
F
Verified Purchase
ForrestA
Chelsea, US
★★★★★ 4
Nice and Simple - but big
Style: 4-Tier Shelf Brackets, Hardware Only.
Nice product, very simple in reality. All screws together. Shelves are probably 12inches high - higher than I wanted so I won't be using it after all - but that is my fault for not realizing how vertically spaced the shelves would be. The unit takes up a lot of vertical wall space. My only dislike (hence the -1 rating) is the large stamped letters on every wall mounting plate. The letters don't appear to mean anything, and are very large and upraised - to me they detract from the overall appearance of the unit. The letters are not possible to get rid of without a grinder or significant file-work and repainting everything (not worth the significant effort that would entail).
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 25, 2025
C
Verified Purchase
CLIIP. Strength & Conditioning
Natrona Heights, US
★★★★★ 5
Great shelving!
Style: 4-Tier Shelf Brackets, Hardware Only.
Love this product
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 19, 2026

recommand products