Human INOS, His tag
SKU: 62560761731

Human INOS, His tag

Sale price$123.75 Regular price$137.50
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 9 - Jul 14

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human INOS, His tagProduct Specification Species Human Synonyms Hepatocyte NOS (HEP NOS), Inducible NO synthase (Inducible NOS; iNOS), NOS type II, Peptidyl cysteine S nitrosylase NOS2, NOS2A Accession P35228 Amino Acid Sequence Protein sequence (P35228, Ala2 Cys200, with C 10*His)

Product Specification


Species Human
Synonyms Hepatocyte NOS (HEP-NOS), Inducible NO synthase (Inducible NOS; iNOS), NOS type II, Peptidyl-cysteine S-nitrosylase NOS2, NOS2A
Accession P35228
Amino Acid Sequence

Protein sequence (P35228, Ala2-Cys200, with C-10*His) ACPWKFLFKTKFHQYAMNGEKDINNNVEKAPCATSSPVTQDDLQYHNLSKQQNESPQPLVETGKKSPESLVKLDATPLSSPRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIMTPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQLTGDELIFATKQAWRNAPRCGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 24.2 kDa Observed MW: 43-55 kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Nitric oxide synthases (NOSs) are a family of enzymes catalyzing the production of nitric oxide (NO) from L-arginine. NO is an important cellular signaling molecule. It helps modulate vascular tone, insulin secretion, airway tone, and peristalsis, and is involved in angiogenesis and neural development. Nitric oxide is mediated in mammals by the calcium-calmodulin controlled isoenzymes eNOS (endothelial NOS) and nNOS (neuronal NOS). Nitric oxide synthase, inducible (iNOS) is an enzyme which is encoded by the NOS2 gene in humans and mice. INOS involved in immune response, binds calmodulin at physiologically relevant concentrations, and produces NO as an immune defense mechanism. In mice, the function of Nos2 in immunity against a number of viruses, bacteria, fungi, and parasites has been well characterized. Nos2 is important for protective immunity against CMV.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 62560761731

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 1067 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
Scotty
West Palm Beach, US
★★★★★ 4
Funny toys
Size: Critter Zoo, Color: 5 Different Animals
Fun toy for our 90 pound doodle, but don’t expect them to last forever. Goofy eyes and features make it a fun toy. If a big dog sits down with it, they will be able to pull it apart. The bird lasted about 5 days with solid supervision. Let’s be honest, no toy is indestructible. The price and number of funny creatures makes this a good buy in my opinion.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 21, 2026
K
Verified Purchase
Kurl Ann Roary
Fort Morgan, US
★★★★★ 5
Great buy for my little mini pinscher!
Size: Critter Zoo, Color: 5 Different Animals
Izzy loves them! Well made and so cute!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026
S
Verified Purchase
Stephanie Mueller
Lexington, US
★★★★★ 1
No. Just no.
Size: Critter Zoo, Color: 5 Different Animals, Size: Critter Zoo, Color: 5 Different Animals
From the Amazon listing, Nocciola promises “Durability Guaranteed” and “Expert Craftsmanship,” boasting multi‑layer composite fabric, chew‑resistant construction, and meticulous stitching. Yeah… about that. Within the first ten minutes, the giraffe’s squeaker gave up the ghost. By the thirty‑minute mark, one of our puppies had already liberated one of its appendages and was preparing to eat it. When I took the giraffe away, he immediately redirected his enthusiasm toward the mallard and removed a wing. Our other puppy went straight for the Red‑Headed Chicken’s throat. She succeeded. She was also making impressive progress on opening the back of its neck. At that point, all three toys had to be confiscated, and the remaining two are still sitting in the box untouched because I value my dogs’ digestive tracts. To be fair, the toys sound fantastic—literally. My puppies adored the squeaks, honks, and crinkles. They had a blast tossing them around and sprinting through the house. But the moment they settled down for a chew session, it was game over. I’m genuinely disappointed that these toys require constant supervision to prevent accidental ingestion, and that my dogs can’t safely enjoy them the way they’re meant to. If your dogs chew even a little, these toys are not worth the investment.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
C
Verified Purchase
Chrisylis
Omaha, US
★★★★★ 5
Good toys
Size: Critter Zoo, Color: 5 Different Animals
As expected. My dog loves them and they seem to be very durable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 16, 2026
M
Verified Purchase
Mr Phish
Boise, US
★★★★★ 3
Dog Toy
Size: Critter Zoo, Color: 5 Different Animals
These things were good for the first 45 minutes than my dog ripped it apart. Buy the variety pack it helps to keep the dog happy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026

recommand products