SKU: 67706604415

Human CD62L , His tag

Sale price$90.00 Regular price$100.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 13 - Jul 18

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD62L , His tagProduct Specification Species Human Synonyms L selectin, Leukocyte adhesion molecule 1 (LAM 1), Leukocyte surface antigen Leu 8, Leukocyte endothelial cell adhesion molecule 1 (LECAM1), Lymph node homing receptor, TQ1, gp90 MEL, SELL, LNHR, LYAM1 Accession P14151 Amino Acid Sequence Protein sequence(P14151, Trp39 Asn332, with C 10*His)

Product Specification


Species Human
Synonyms L-selectin, Leukocyte adhesion molecule 1 (LAM-1), Leukocyte surface antigen Leu-8, Leukocyte-endothelial cell adhesion molecule 1 (LECAM1), Lymph node homing receptor, TQ1, gp90-MEL, SELL, LNHR, LYAM1
Accession P14151
Amino Acid Sequence Protein sequence(P14151, Trp39-Asn332, with C-10*His) WTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNGGGGSHHHHHHHHHH
Expression System HEK293
Molecular Weight Theoretical:34.7kDa Actual:50-70kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

L-selectin, also known as CD62L, is a cell adhesion molecule found on the cell surface of leukocytes, and the blastocyst. L-selectin plays an important role in both the innate and adaptive immune responses by facilitating leukocyte-endothelial cell adhesion events. These tethering interactions are essential for the trafficking of monocytes and neutrophils into inflamed tissue as well as the homing of lymphocytes to secondary lymphoid organs. L-selectin is also expressed by lymphoid primed hematopoietic stem cells and may participate in the migration of these stem cells to the primary lymphoid organs. In addition to its function in the immune response, L-selectin is expressed on embryonic cells and facilitates the attachment of the blastocyst to the endometrial endothelium during human embryo implantation.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 67706604415

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 1180 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
P
Verified Purchase
PS
Los Angeles, US
★★★★★ 3
Good place to start
Format: Paperback
I am an independent college adviser based in California and I recommend this book to my clients but only at the very beginning of the process (mostly to the parents of rising high school freshmen and sophomores). This book is a good place to start especially for many of the foreign educated or immigrant families, who are new to the US College Admission process. The parents do tell us that the book loses its effectiveness once they gain knowledge of the process and/or they begin working one-on-one with an independent and/or become more conscious about meeting the high school counselors early in the process. I personally like the fact that once this book is overviewed by the families, we can spend more time addressing specific concerns and giving more customized advice. As a result we only need quarterly meetings and these meetings are extremely targeted. The problem with this book though is it reads like a huge information session by colleges. Those of you who have attended some of the information sessions will know what I mean. The insights provided by the deans and admission officers of various colleges sound somewhat like a "sales pitch" at times and at other times are misleading. I also recommend my students to keep their knowledge up to date by referring to various free resources such as Nancy Griesemer's educational articles in Washington Examiner Online, or the Choice Blog. I spend considerable time volunteering my services at a high school in a mixed/low income neighborhoods; I wish the price had been more reasonable considering that this is a basic book. Lastly as members of NACAC (National Association of College Admission Counseling), all of us in the admissions field (College Admission Officers, High School Counselors, and Independent Counselors) subscribe to certain codes of ethics and one of the Statements of Good Practice says this about Fairness and Equity: We believe our members have a responsibility to treat one another and students in a fundamentally fair and equitable manner. Unfortunately, Ms. Mamlet and Ms. VanDeVelde do a great disservice by being disrespectful to a large community of Independent College Advisers, many of whom are needed when the high school counselors are juggling with case loads of 200-300 students each and are unable to keep up with the changing scene of college admissions (either due to the lack of funding or time). Gone are the days when people went to some "quack-independents" who promised admissions to Ivy Leagues--sure there are some of those but if families are careful in their research, they will soon find out that these Independents do not belong to any authentic professional organizations such as the NACAC, HECA or IECA. Most students who come to the authentic professionals are motivated to find their right fit college, explore their own strengths and weaknesses and find the best match for their talents, interests and financial situation. Most independents offer services that are reasonably priced. If Ms. Mamlet and VanDeVelde show more commitment to researching folks on the other side of the spectrum, I am sure that their book will be more enlightening.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 18, 2013
A
Verified Purchase
AGB
Carnegie, US
★★★★★ 5
Best College Info Book Ever!
Format: Paperback
I have read dozens of college-related books in the past 4 years, and this one ranks the highest by far. Written by industry experts and the authors got a lot of top talent to contribute. Full of real-life advice and useful information that is actually true (I fact-checked this against some other info). I read parts of it out loud to my junior on the plane en route to a college tour, and she actually listened! Humor is always appreciated, and these authors use it without going overboard. Great information, well-presented. A must-read!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 22, 2013
B
Verified Purchase
B. Jones
Port Orchard, US
★★★★★ 5
A Must-Read for College (and Even High School) Students
Format: Paperback
First of all, this book really cuts to the point. If you are skilled with skim-reading, you can get this book in about 2 1/2 to 3 hours. Second, while these strategies are currently untested by me, they seem really practical. Rather than saying "study" or "write paper" or "take test", Dr. Newport lays down specific, useable guidelines for all areas that are intended to cut down on time spent on schoolwork. This helps you with more time to have fun, do extracurricular activities, or work 60 hours a week (like I will soon be doing). Third, this is THE anti-procrastination book, although I don't get the concept of starting term papers a month before they're due as the examples did. The whole concept behind this book is making sure you've got as little work going as possible that takes as little time as possible. Doing things upfront will ease your load later when the assignments and papers start rolling in and out. There are only a couple of issues I have with the book. 1) Dr. Newport almost makes the use of personal laptops compulsory in college. I get why it would be such an asset, but for some of us it is more of a liability than an asset. I really believe one can get through college without a laptop at a much smaller personal expense than the costs of buying a laptop/accessories, printer, ink, etc. If you already bought one, that's one thing, but if you haven't, why do you need one? Just use pen/paper and the computer labs' computers and printers. With the printers, odds are you're paying the same amount for 1000 pages that you would for toner (paper is free with the way they price it), and you don't have to drop the cost upfront, but pay as you need the printer. Financially, you're better off skipping the personal printer. 2) He didn't discuss what format to purchase textbooks, but considering he was so insistent on portability, I would probably haphazard a guess that a hard copy is the only way to go. Sure it may be expensive, but what if your Kindle or iPad gets stolen? Overall, highly, highly recommended. Get this for your child as an early (or very early) graduation present. Teaching them these things will save them a lot of headaches later on. One last note: This book is not for the lazy. If you aren't willing to do the work, don't expect this book to help. However, if you're someone like me who's sick of lazy and wants to convert, this book IS for you!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 18, 2012
R
Verified Purchase
Ricky Luis
Alexandria, US
★★★★★ 5
One more crappy college study guide
Format: Paperback
When I was taking 4 classes at my local community college, I tried to follow the part of the book that said just to learn math by examples. I ended having to drop the class because at first I was actually ahead of the professor. Then I tried this stupid book's technique of learning by examples and I ended up falling behind. The same can be said of "What smart students know" it's actually a good technique (smart students), but you end up spending hours thinking up questions. Questions can be a part of the process, but it can't be the whole process. I just bought an online course than is way better than both of these combined. It's so good. The point I'm at in the course you can memorize up to 50 items in reverse and forward. You can also tell which place in the list. An example could be The order of my hallway: Dog = front door Cat = wall Duck = light switch Printer = holder Hitler = chair MAO = rug Goku = ceiling light Kurrin = mirror Gohan = heater Frieza = painting You would then connect / visualize each word / picture with a part of your house. The rule is to visualize each for only 6 seconds while recalling can only take 6 seconds. If you miss one you have to do the six second process again until you make no mistakes. P.S. I'm not telling anyone the name of the course or where to buy it. I want to be ahead of all other students. Edit: I'm back in college taking two college level courses. While I don't agree with everything in this book (I have to re-read it) I agree with 80-85% of the methods used in this book that I remember. Such as not doing the reading he was right. I haven't done the reading in my psychology 101 class and have only focused on taking / memorizing / learning the notes and while I haven't gotten a grade yet, I actually feel I'm learning enough and today in class I note notes from a documentary we watched. The professor said to do the reading for chapter 2 of the textbook. I'm not even going to do it. I'm going to just take notes in class then go over the reading. I did this for my 1st set of notes and I didn't understand something in the lecture notes. I ended up re-reading that / part / example [it was on the scientific method]. I remember from taking my developmental math class that the professor was actually doing examples (even though I couldn't figure out from what part of the book they were from and / or I couldn't write every example like he said) If I had just asked questions and either watched videos on Youtube I would've probably remembered the material from that class. I'll do another edit once I'm done with classes. I'm also going to write / provide a list of books that I think are good for learning and have good advice for college. Edit: I ended up trying to do the advice from this book and if I didn't look up the answers for the test for my psychology class I wouldn't be in college today. I'm not saying that all of this book is bad but I went from thinking that 85% of it is good to now thinking that 50% of this book is good. The other half is crap. Such as the technique for Q/E/C he doesn't give any examples or enough examples. The other advice like making your own problem sets I wouldn't have thought of. Even though this is an all right technique your wasting time because you can just practice doing other peoples problems (like those online or from a professor) or do Bullet point concept from another book I read (I'm going to provide a list once I'm done with this review). The one technique that is very good is the lecture technique he mentions in the book. For some reason, this technique helps with putting material into memory. His section on writing papers is also very good. His explanation on how to prepare for and take exams is also good. Also, he should have made the book more visual and put actual writing from actual students other than that it's an all right book. Here's the list of books I've read (so far) that will most likely get you A's College Rules https://www.amazon.com/College-Rules-4th-Survive-Succeed/dp/1607748525/ref=sr_1_1?s=books&ie=UTF8&qid=1530133408&sr=1-1&keywords=college+rules Guaranteed 4.0 https://www.amazon.com/Guaranteed-Follow-3-Step-Plan-Dont/dp/0974264806/ref=sr_1_1?s=books&ie=UTF8&qid=1530134451&sr=1-1&keywords=guranteed+4.0 How to study in college https://www.amazon.com/How-Study-College-Walter-Pauk/dp/1133960782/ref=sr_1_4?s=books&ie=UTF8&qid=1530134633&sr=1-4&keywords=how+to+study+in+college The only book I've read from cover to cover is GT 4.0 it's probably the best in my opinion because the system in this book will get you A's. The only reason last semester I didn't get A's was because I didn't follow the system to the t. If you follow the GT 4.0 system to a t and don't get all A's she'll give you $100. Hope this helps. Edit 2020: From what I remember reading this book, this applies to college level courses and even at the same time I tried using his question / evidence technique while taking a psy101 class and couldn't do it. Also he's right to a very large degree about living off of lecture notes. Living off of the lecture notes IMHO can only be done if it's a science science class or a college level math class. I'm currently taking a pre-req class and the professor explains everything. Along with the Guaranteed 4.0 technique this is a pretty decent book.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 24, 2012
S
Verified Purchase
S. Bandy
Lowell, US
★★★★★ 4
Wish I had read this sooner
Format: Paperback
This book is not that revolutionary, but very helpful. It essentially tackles three main problem areas for college students: 1) time management skills, 2) studying and exam prep, and 3) essay writing. Some of these are common sense things that many people resist implementing. If you are struggling with college, or are a high school senior unsure of what to expect in college, this book is very helpful. The true value in this book, for me at least, was in providing the satisfaction that these strategies worked. I would often start out a semester by doing the things listed in the book. I would manage my time, study effectively for exams, thoughtfully plan out papers and assignments. Halfway through the semester, I always had straight As. But as finals crept up, I would panic. Since every other student spent hours in the library studying, I abandoned the effective strategies to follow suit. As a result, my final exam grades were inconsistent and my final papers were always rushed. This book gave me the satisfaction of knowing that I can trust these time saving strategies. You do not need to spend hours and hours on projects to get a good grade. It's okay to not spend hours in the library studying for a final. Trust that these strategies work, and enjoy your stress-free semester. But, the book does have faults. While this book provides very useful information, I feel it misses two aspects of the college experience that can have a large impact on your grade: presentations and group projects. (Also the dreaded group presentation). While you can implement some of these strategies in these situations, it would be nice to know how top students manage working in group project settings, especially those that require research. I can't tell you how many times I've been in a group project where half the group doesn't show up to meetings, members refuse to do their work, or people drop the class halfway through the project. I still haven't figured out an adequate way to deal with these situations besides just doing the work myself at the last minute. Bottom line, this book is well worth the money. Whether you are a college senior or a high school senior and everything in between, this book will help you as long as you faithfully implement the strategies. But do search out other resources for help with managing group projects.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 12, 2012

recommand products