Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 9 - Jul 14
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
B7-H7/HHLA2 His Tag Protein, CynomolgusProduct Specification Species Human Synonyms B7 H7, HHLA2, B7 Homolog 7 Accession XP_005548285 Amino Acid Sequence Ile21 Asn345, with C terminal 8*His
Product Specification
| Species | Human |
| Synonyms | B7-H7, HHLA2, B7 Homolog 7 |
| Accession | XP_005548285 |
| Amino Acid Sequence | Ile21-Asn345, with C-terminal 8*His IFLSAFFTYVPMNEQIIIGRLGEDIILPSSFERGSEVVIHWKYQDSYNSYNVHSYYKGSGRLESQDTRYANRTSLFYNEIQNGNASLFFRRLSLLDEGIYTCYVGTAIQAITNKVVLKVGVFLTPMMKYEKRNTNSFLICNVLSVYPRPIITWKMDNTPISENNMQETGSLGPFSINSTLNITGSNSSYECTIENSLLKQTWTGRWTMKDGLHKMQSEHVSLSCELVNDYFSPNQDFKVTWSRMESGISSILAYYLSSSQNTTFYESRFSWNKELKNQSDFSMNLTDLSLSDSGEYLCNISSDEYTLLTIHTVHVEPSQETASDNGGGSHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 60-72kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference |
1、Zhu Y. et al. (2013) B7-H5 costimulates human T cells via CD28H. Nat Commun. 4. 2、Dong Z. et al. (2018) EGFR may participate in immune evasion through regulation of B7-H5 expression in non-small cell lung carcinoma. Mol Med Rep. 18: 3769-3779. |
Background
Human endogenous retrovirus-H long terminal repeat-associating protein 2 (HHLA2; also known as B7H7 or B7H5) is the only member of the B7 protein family found in humans. HHLA2 cannot be found in mice and is mainly expressed in human breast, lung, thyroid, melanoma, pancreas, ovary, liver, bladder, colon, prostate, kidney and esophagus cancer cells, activated myeloid cells, monocyte-derived macrophages and dendritic cells. In addition, HHLA2 interacts with the co-receptor CD28H to stimulate T cell proliferation, differentiation and the production of cytokines, including IFN-γ, IL-2 and IL-10. In terms of cancer, higher expression levels of HHLA2 were previously reported to be associated with poorer prognoses or higher degrees of tumour invasion in lung carcinoma, hepatocellular carcinoma and prostate cancer.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy