SKU: 77673789900

Human IL-8 , His tag

Sale price$166.50 Regular price$185.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 12 - Jul 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-8 , His tagProduct Specification Species Human Synonyms C X C motif chemokine 8, Chemokine (C X C motif) ligand 8, Emoctakin, Granulocyte chemotactic protein 1 (GCP 1), Monocyte derived neutrophil chemotactic factor (MDNCF), CXCL8 Accession P10145 Amino Acid Sequence Protein sequence(P10145, Ser28 Ser99, with C 10*His) SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENSGGGGSHHHHHHHHHH Expression System CHO Molecular Weight Theoretical: 10.

Product Specification


Species Human
Synonyms C-X-C motif chemokine 8, Chemokine (C-X-C motif) ligand 8, Emoctakin, Granulocyte chemotactic protein 1 (GCP-1), Monocyte-derived neutrophil chemotactic factor (MDNCF), CXCL8
Accession P10145
Amino Acid Sequence

Protein sequence(P10145, Ser28-Ser99, with C-10*His) SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENSGGGGSHHHHHHHHHH

Expression System CHO
Molecular Weight

Theoretical:10.1kDa Actual:10kDa

Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Interleukin 8 (IL-8 or chemokine (C-X-C motif) ligand 8, CXCL8) is a chemokine produced by macrophages and other cell types such as epithelial cells, airway smooth muscle cells and endothelial cells. Endothelial cells store IL-8 in their storage vesicles, the Weibel-Palade bodies. IL-8 is initially produced as a precursor peptide of 99 amino acids which then undergoes cleavage to create several active IL-8 isoforms. In culture, a 72 amino acid peptide is the major form secreted by macrophages. Interleukin-8 is a key mediator associated with inflammation where it plays a key role in neutrophil recruitment and neutrophil degranulation. IL-8 has also been implied to have a role in colorectal cancer by acting as an autocrine growth factor for colon carcinoma cell lines or the promotion of division and possible migration by cleaving metalloproteinase molecules. It has also been shown that IL-8 plays an important role in chemoresistance of malignant pleural mesothelioma by inducing expression of transmembrane transporters.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 77673789900

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 2391 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
LindyB
Massapequa, US
★★★★★ 5
Great dressy sneaker to wear with business casual or jeans
Size: 11, Color: British Tan/Ivry
I got these for my husband to wear with jeans or business casual dress pants. They look sharp and professional and dress up jeans if you're going out. He says they fit comfortably and he can walk on them all day without his feet hurting. They are beautiful genuine leather so they don't get stinky. I got my husband's normal size and they fit to size.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 11, 2026
T
Verified Purchase
timothy scalabrelli
Charlottesville, US
★★★★★ 4
Comfortable
Size: 9, Color: Black/Ivory
Most comfortable and roomy shoes I ever wore. Great for insoles. Looks nice too. The base of the shoe is a bit too thick but it’s fine.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 5, 2025
B
Verified Purchase
BBZ
Battle Creek, US
★★★★★ 5
Very nice, but sizing is inconsistent
Size: 10 Wide, Color: Ivory/White/British Tan
All of these Cole Haan shoes are extremely well made and I like the styling. On the other hand, the sizing is very inconsistent and you may end up having to do a lot of returns trying to find the right size. Then if you get a different color of it, you may find the sizing different yet again. If you find your right zie, they are really nice shoes at a very reasonable price for the quality.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 6, 2026
L
Verified Purchase
Lofidelityrockr
San Leandro, US
★★★★★ 5
I love this brand. These shoes look and fit great!
Size: 13 Wide, Color: Black/White/Black
I love wearing Cole Haan shoes. This is the second pair I’ve owned and the style just gets me. I’ve worn these to work at a great professional job every day, not just casual Friday. I wear these when I head out shopping or to dinner. They are functional, comfortable, built for regular and bigger wider feet and comfortable. I am 6 feet tall and my feet have changed size over the years to me needing a wider shoe to relieve pressure on my toes and front wide porting of my foot. So the 13W feels great and still walks the same as a regular 14 but more comfort for me. They look amazing and qualify in some offices as dress shoes (depending on company rules they will justify a sneaker as a shoe with the tan colored “gum” sole as a sneaker) so check company policy. The black sole on this makes it look more dressy. I am switching out the laces to match my previous Cole Haan because I think the white shoelaces look better. As an adult, aside from my Kenneth Cole boots Reaction boots and Doc Marten’s these are the only shoes I will pay 3 digits for. This looks like skater shoes but with a more mature look.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 19, 2025
B
Verified Purchase
BWolfeJR
Boise, US
★★★★★ 5
I am certainly glad I found them and finally ordered
Size: 10, Color: Ivory/White/British Tan
A bit bulkier than my Stan Smiths Leather versions, but actually more comfortable. They seem to be a bit "clunkier" looking than a streamline Stan Smith, but it's a matter of style. It works for a change of pace. Gets or picks up dirt a bit, but cleans well, except the canvas part. Has lasted almost 6-8 months with very little signs of wear. Feels very secure in any type of weather or condition. Great alternative or addition to having a pair of Stan Smiths.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026

recommand products