SKU: 87256487105

CD3 epsilon Fc Chimera Protein, Cynomolgus

Sale price$243.00 Regular price$270.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 12 - Jul 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD3 epsilon Fc Chimera Protein, CynomolgusProduct Specification Species Cynomolgus Synonyms CD3,T3e,CD3epsilon Accession Q95LI5 Amino Acid Sequence Gln22 Asp117, with C terminal Human IgG1 Fc

Product Specification


Species Cynomolgus
Synonyms CD3,T3e,CD3epsilon
Accession Q95LI5
Amino Acid Sequence

Gln22-Asp117, with C-terminal Human IgG1 Fc

QDGNEEMGSITQTPYQVSISGTTVILTCSQHLGSEAQWQHNGKNKEDSGDRLFLPEFSEMEQSGYYVCYPRGSNPEDASHHLYLKARVCENCMEMDIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 37-43kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

CD3 has five kinds of peptide chains, namely γ chain, δ chain, ε chain, ζ chain and η chain, all of which are transmembrane proteins. The transmembrane region of CD3 molecule connects to the transmembrane region of two peptide chains of TCR through salt bridge, forming the TCR-CD3 complex, which is involved in nervous system development and positive regulation of cell adhesion. CD3 acts upstream of or within several processes, including positive regulation of T cell activation; positive regulation of cytokine production; and regulation of signal transduction.CD3 is located in several cellular components, including dendritic spine; external side of plasma membrane; and immunological synapse. Part of alpha-beta T cell receptor complex. CD3 is expressed in colon and hemolymphoid system.

Bispecific therapies targeting CD3, so-called T-cell engagers (TCE), belong to the new spectrum of anti-tumor immunotherapies stimulating T-lymphocytes. TCE are unique constructs targeting the MHC-independent CD3 epsilon subunit (CD3e) and a tumor antigen. Some TCE are in advances development, with promising results targeting CD20 and BSMA in lymphoma and myeloma. These successes have relaunched the development of TCE in solid tumors, bringing mixed results so far (notably in terms of tolerance). Still, TCE pave the way to new immunotherapy in tumors considered to be refractory to inhibitors of immune checkpoints such as prostate cancer or colorectal cancer.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 87256487105

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 655 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
E
Verified Purchase
Edward J. Knight
Pawtucket, US
★★★★★ 4
Overall sound thesis worthy of thoughtful consideration
Format: Kindle
Choudary’s book has the tag line, “Who wins when AI restacks the knowledge economy.” While the book is annoying in sections, vague in others, and prone to jargon in yet more locations, the basic thesis is sound and compelling. It’s worth considering. Choudary’s main argument is that the winners after AI technology is widely adopted will be those who take a systems view of their business rather than simply upgrading individual elements within it. He backs this with several examples based on past technological disruptions and hypothetical case studies. He argues that the best advantages from AI will come from improved communication and managing risk. He supports these arguments reasonably well within the chapters. He also includes 10 Takeaways at the end of each chapter, which is extremely helpful for recapping and making sure the reader understood the thesis. What gets annoying is Choudary goes back to the same case studies again and again and again. I reached the point of saying, “the horse is dead. Please stop flogging it.” Next, some of his arguments about things like “managing risk” are vague—there’s not enough about specific risks to be useful, which leaves AI as a magic wand to wave. Finally, as with many business writers, Choudary occasionally (but not overwhelmingly) drops into jargon like “technological solutionism.” Overall, I recommend the book. It’s made me think, even as I struggle to apply the principles to my own business.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 22, 2025
N
Verified Purchase
NehSin
Omaha, US
★★★★★ 5
Must read - Insightful and Trusted
Format: Paperback
Reading “Reshuffle” was both intellectually energizing and personally relevant for me. Sangeet Paul Choudary’s work is more than just a business strategy manual, it’s a lucid roadmap for thriving amid constant change. Having spent the past decade steering our teams through multiple waves of technological disruption, I recognized my own journey in Choudary’s stories of platform transformation. His concepts of “connectors” and “combinators” spoke directly to challenges I’ve faced: breaking down silos, fostering creative recombination of ideas, and unlocking new sources of value in our organization. There were moments while reading when I paused, reflected on recent strategy sessions, and realized how much we could benefit from the frameworks outlined here. What truly set “Reshuffle” apart for me was Choudary’s ability to tie cutting-edge AI trends to everyday executive decisions. When he wrote about the collision between legacy content pipelines and new generative workflows, it echoed conversations I’ve had with other executives. “Reshuffle” reminded me that constant evolution isn’t just a necessity, it’s an opportunity to lead with optimism and vision. Choudary’s voice is empathetic, insightful, and refreshingly practical, making the book feel like advice from a trusted colleague as much as a renowned thought leader. In short, “Reshuffle” is a must-read for anyone tasked with steering a tech company through turbulent times. For me, it has become a personal touchstone for navigating and embracing what’s next.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 20, 2025
R
Verified Purchase
Renato Beninatto
Lexington, US
★★★★★ 5
Finally, a framework that makes sense of AI's impact on knowledge work
Format: Kindle
Most books about AI focus on task automation and productivity gains. Reshuffle does something different: it explains how AI restructures entire systems through three constraints: tasks, coordination, and risk. For someone working in the language services industry, this book was revelatory. It helped me understand why so many conversations about AI and translation feel misdirected. We debate whether AI will replace translators when the real question is: how will AI reshuffle who creates value in language services? Choudary's central insight is that when AI removes old constraints (like scarcity of expertise), value doesn't disappear. It migrates to new coordination and risk management challenges. This applies across all knowledge professions, not just translation. Section 2 on knowledge work is particularly strong. It shows that lawyers, consultants, accountants, and translators are all experiencing the same fundamental transformation. We're not uniquely vulnerable; we're part of a larger reshuffling of how knowledge creates value. If you're trying to position yourself or your organization for what's coming, this book offers the clearest framework I've found. It's not about having better AI tools. It's about understanding where value pools are forming in the new system. Recommended for anyone in knowledge work who wants to move beyond surface-level AI discussions.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 25, 2026
A
Verified Purchase
Amazon Customer
Natrona Heights, US
★★★★★ 5
Not like any other how-to book on AI--Eric Swanson's Review
Format: Kindle
Reshuffle is not another “how to use AI” guide. It’s a powerful, big-picture look at how AI is reshaping the very foundations of the knowledge economy. Sangeet doesn’t just explore tools—he reveals the tectonic shifts in how knowledge is created, distributed, and valued. Most people use AI to improve old systems; this book shows why the winners will be those who understand and adapt to entirely new ones. Using powerful examples from history, like the bar code, container boxes and the Maginot Line, Sangeet creates powerful frames for new ways of thinking. Insightful, clear, and compelling, Reshuffle is essential reading for anyone who wants to lead in the age of AI
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 23, 2025
P
Verified Purchase
PG
Massapequa, US
★★★★★ 5
Would your card still be in the deck after the AI reshuffle?
Format: Paperback
AI’s impact on knowledge workers, and on enterprises, is immense. “Good enough” and inexpensive answers now abound, and the premium once commanded by knowledge workers seems to be slipping away. Enterprises are pinning their hopes on AI-driven efficiencies to stay competitive and relevant. Emotions surrounding this technological breakthrough range from doom and gloom to glee and hope. Sangeet’s Reshuffle helps build a mental model to understand, navigate, and survive this change, and even thrive in it. It’s a refreshing departure from the usual first-order effects and fallacies that dominate social and print media. For knowledge workers, staying relevant is becoming increasingly difficult, especially as the very definition of “relevance” evolves. Simply acquiring AI skills may not suffice if the underlying value of those skills has shifted. Judgment, systems thinking, and coordination will become more valuable. Remaining well-paid and autonomous will require protecting and growing contextual and economic value within this transformed system. Simple, but not easy. At the enterprise level, applying AI for task-based efficiencies in one area often shifts constraints elsewhere. Using systems thinking and positioning AI as the engine, not merely a tool, for innovation and coordination across the value chain will give enterprises a fighting chance to stay competitive. While the metaphorical pie may grow, simply “playing the same game better” won’t earn you a proportional share of it. Existing systems will be unbundled and re-bundled into offerings that solve emerging constraints. Coordinating across the value chain and taking responsibility for delivering customer outcomes will be key to unlocking outsized gains.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 29, 2025

recommand products