SKU: 9157598489

Human CGA, His tag

Sale price$76.50 Regular price$85.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 13 - Jul 18

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CGA, His tagProduct Specification Species Human Synonyms Anterior putuitary glycoprotein hormones common subunit alpha; Choriogonadotropin alpha chain; Chorionic gonadotrophin subunit alpha (CG alpha); Follicle stimulating hormone alpha chain (FSH alpha); Follitropin alpha chain Accession P08515 Amino Acid Sequence Protein sequence(P01215, Ala25 Ser116, with C 10*His)

Product Specification


Species Human
Synonyms Anterior putuitary glycoprotein hormones common subunit alpha; Choriogonadotropin alpha chain; Chorionic gonadotrophin subunit alpha (CG-alpha); Follicle-stimulating hormone alpha chain (FSH-alpha); Follitropin alpha chain
Accession P08515
Amino Acid Sequence

Protein sequence(P01215, Ala25-Ser116, with C-10*His)
APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKSGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 11.8kDa Actual: 25kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

Glycoprotein hormones, alpha polypeptide is a protein that in humans is encoded by the CGA gene. The gonadotropin hormones, human chorionic gonadotropin, luteinizing hormone, follicle-stimulating hormone, and thyroid-stimulating hormone are heterodimers consisting of alpha and beta subunits that are associated non-covalently. The alpha subunits of these four human glycoprotein hormones are identical; however, their beta chains are unique and confer biological specificity. The protein encoded by this gene is the alpha subunit and belongs to the glycoprotein hormones alpha chain family.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 9157598489

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 565 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
cruisingal
Boise, US
★★★★★ 5
Serves purpose and holds what it was intended to
Color: 2 Tier-Black, Color: 2 Tier-Black
I like it. Keeps things organized and handy in small kitchen. The attachable bin holding my brushes I put on outside of unit not inside as company pics show it. That bin only has one clip to hold it in place. This makes it a little wobbly if you want to place it on the outside like I did. I used 2 trash bag twisties to help tighten it into place. Doing this made it no longer lose and the inside area space larger to hold both of my soaps. Fits everything I need it to. I appreciated the little lever on bottom that moves for water drainage. My sink design doesn’t work for the other drainage design I found these to have online.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 6, 2026
M
Verified Purchase
Michelle H.
Charlottesville, US
★★★★★ 5
My new kitchen favorite!!! Looks just like picture!
Color: 2 Tier-Black
Love this, looks just like picture. Fits perfect by my sink and the drain spout positions right into sink. Holds quite a few things. A kitchen must have! Well made, stays put, easy to rinse when needed and my room mate loved it too!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 28, 2026
A
Verified Purchase
Angela
Belleville, US
★★★★★ 5
Great sink organizer
Color: 1 Tier-Black, Color: 1 Tier-Black
I've been searching seems like forever for something to make my kitchen sink look more organized and this caddy solves my problem!! I found a different use for the basket that holds a scrub brush since I don't use one of those. Nice design that fits my kitchen objects and no worries about removing a tray to empty water out. I used the adhesive holder to attach it to the wall behind the sink but one corner is peeling off, causing the basket to hand on that side. :( It would have been nice to have a replacement for that, but overall I'm pretty impressed with this thing!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 19, 2026
T
Verified Purchase
Theresa Rost
Charlottesville, US
★★★★★ 5
looks great in my kitchen
Color: 2 Tier-Black
This goes together easy and works great.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026
D
Verified Purchase
Dadhich Sawant
Pawtucket, US
★★★★★ 5
Nice Product
Color: 2 Tier-Black, Color: 2 Tier-Black
Super Handy and So Stylish — A Must-Have for Any Kitchen! I’m really impressed with the Sinnsally Kitchen Sponge Holder! It’s simple, practical, and makes keeping my sink area neat so much easier. The 2-tier design is brilliant — the top shelf holds my sponges perfectly, while the bottom area keeps scrubbers and brushes organized and easily accessible. The stainless steel looks sleek and modern, and it has held up beautifully with daily use. Water drains well so everything dries quickly, and cleanup is a breeze. No more soggy sponges sitting around! Installation was quick and easy — it fits nicely right by the sink without taking up too much space. This little holder has made a big difference in keeping my kitchen tidy. Highly recommend for anyone who wants a clean, organized sink area with a touch of style!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 3, 2026

recommand products