Frizzled-7/FZD7 His Tag Protein, Human
SKU: 95558394694

Frizzled-7/FZD7 His Tag Protein, Human

Sale price$247.50 Regular price$275.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 8 - Jul 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Frizzled-7/FZD7 His Tag Protein, HumanProduct Specification Species Human Synonyms FZD7, Frizzled 7, FzE3, Fz 7, hFz7 Accession O75084 Amino Acid Sequence Gln33 Leu185, with C terminal 8*His QPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYLGGGSHHHHHHHH Expression System HEK293 Molecular Weight 25 33kDa Purity >95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag

Product Specification


Species Human
Synonyms FZD7, Frizzled-7, FzE3, Fz-7, hFz7
Accession O75084
Amino Acid Sequence Gln33-Leu185, with C-terminal 8*His QPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYLGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 25-33kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Sagara N. et al. (1998) Molecular cloning, differential expression, and chromosomal localization of human frizzled-1, frizzled-2, and frizzled-7. Biochem Biophys Res Commun. 252(1): 117-122.

Background

Frizzled-7 is a member of the Frizzled family of unconventional G-protein-coupled glycoprotein receptors for the Wnt signaling pathway. The Wnt genes encode a large family of glycoproteins that are essential in development and tissue maintenance. In the adult, Frizzled-7 is expressed in skeletal muscle, especially in satellite cells that mediate muscle regeneration in response to Wnt-7a. It is expressed in embryonic stem cells (ES), contributing to self-renewal signaling. It has been implicated in mesenchymal-to-epithelial transition in colorectal cancer. Frizzled-7 mRNA has also been detected in adult heart and placenta.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 95558394694

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 471 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
LaShelle Lee
Lake Worth, US
★★★★★ 5
Impressive Quality and Style – A Perfect Prom Look!
Size: Small, Color: Maroon Collar Black
I purchased the YND Men's 3-Piece Slim Fit Tuxedo Suit Set for my son's prom, and I couldn’t be more thrilled with the results. From the moment he put it on, it was clear this suit was something special. The fit was absolutely sharp and flattering, perfectly hugging the frame without being too tight — just the right balance of tailored and comfortable. The material feels high-quality and looks even better in person — smooth, sleek, and polished. It held its shape beautifully throughout the night and gave my son a sophisticated, modern look that turned heads and earned him plenty of compliments. You can tell this suit is well-made with great attention to detail, from the stitching to the lining. It easily rivals much more expensive brands. I’m so impressed with the value and style that I’ll definitely be purchasing from this company again. If you're looking for a tuxedo that delivers elegance, confidence, and exceptional quality without breaking the bank — this is the one!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 10, 2025
A
Verified Purchase
Amazon Customer
Los Angeles, US
★★★★★ 5
A Good Value
Size: Small, Color: Black, Size: Small, Color: Black
The suit is a good value. Ordered for senior prom for my son. He is 5’10 athletic build and between 165-170 lbs so we ordered the small since he wanted a slim fit and nothing that would be very loose. The suit fit him great, not too snug , the jacket has a satin finish on the lapel and edge of pockets which gives it an elevated elegant look. The jacket has an interior pocket but the rest are just for aesthetic as they do not open. I did have to cut a small slit in order to use the pocket square. The pants fit like a glove but you may want to size up if you are very muscular. The material is light weight which is perfect for prom season or warmer weather. The vest was oversized but we were not planning to use the vest anyway. Quality: several hanging threads that needed to be snipped but no big deal, the stitching was even and straight and the interior had piping of a complimentary fabric. After a full night of dancing and activities he did not have any issues with stitching breaking or splitting of seams. The buttons are black with a silver edge which give the suit some sophisticated flair but keep this in mind if you plan to style with gold. Overall, I am very pleased with this suit considering it’s price point. It’s perfect for a teen that will attend various senior events. Shipping took 2 weeks so plan accordingly and pay attention to the expected delivery date.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2022
J
Verified Purchase
JENNY COLLINS
Boise, US
★★★★★ 4
Decent Tux but no customer service
Size: XX-Large, Color: Deep Grey
Decent tux for the money. Wish that we could have ordered different sizes for the jacket and the pants. The vest/jacket fits great but the pants were too big. Ended up having to buy separate pants. The add says that if you email them for a different size, they will help you out, but we never heard anything back from our email.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 15, 2025
J
Verified Purchase
Jokenyatta Hampton
West Palm Beach, US
★★★★★ 5
Size is right
Size: X-Small, Color: Deep Grey
At first I was afraid the tux wouldn't arrive on time for me to see how it fit my son. Now that is has, I realized I was worried for nothing...it fits perfectly!!!! Just follow the size chart. Thank you so much for this inexpensive option!!!!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 20, 2026
J
Verified Purchase
jessica
Chelsea, US
★★★★★ 5
Worth it! Good quality for the price
Size: Large, Color: Black Collar White, Size: Large, Color: Black Collar White
Good quality! My husband loved this tux for our elopement, and it looked great on him. We just steamed out the wrinkles, and it looked flawless.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 7, 2026

recommand products