VHL His&AVI Tag Protein, Human
SKU: 96976910355

VHL His&AVI Tag Protein, Human

Sale price$468.00 Regular price$520.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 9 - Jul 14

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

VHL His&AVI Tag Protein, HumanProduct Specification Species Human Synonyms HRCA1 Protein, Human; pVHL Protein, Human; RCA1 Protein, Human; VHL1 Protein, Human Amino Acid Sequence Met1 Asp213, with N terminal His SUMO & C terminal AVI Tag

Product Specification


Species Human
Synonyms HRCA1 Protein, Human; pVHL Protein, Human; RCA1 Protein, Human; VHL1 Protein, Human
Amino Acid Sequence

Met1-Asp213, with N-terminal His SUMO & C-terminal AVI Tag

MGSSHHHHHHSSGLVPRGSHMASMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGMPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGDGLNDIFEAQKIEWHE

Expression System E.coli
Molecular Weight 45 kDa
Purity

>85% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag Avi Tag, His Tag
Physical Appearance Liquid
Storage Buffer 20 mM PB,100 mM KCl,0.1 mM EDTA ,2 mM DTT, pH 7.5
Reconstitution A hardcopy of datasheet with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 96976910355

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 2096 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
W
Verified Purchase
Will Peppers jr
Grantham, US
★★★★★ 5
I can wire my 0gage wre finally
Size: 300A Fuse Holder
The speed of service and delivery fused at different Amps voltage to purchase appearance is always a great addition and skar audio is always a head of the game I love skar audio I have been running their RP series amps I have all of them except the 4500.1 I bought this for my 07 Wolfsburg jetta with a 15 dual 2ohm down to 1ohm with the RP 3500.1 and it slumps and hits so low the skar box foe my single 15evl series..is tuned to 30htz..n when it hits that level and lower man u know it ..o call it the 23htz (23hurter)..explosive always excellent quality and functionality thanks 😊
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 28, 2025
K
Verified Purchase
Kraig Cash
Battle Creek, US
★★★★★ 5
Top notch
Size: 300A Fuse Holder
Very good quality
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 8, 2026
A
Verified Purchase
Awesome works just like they said it does.
Phoenix, US
★★★★★ 5
It’s good
Size: 300A Fuse Holder
It does it’s job.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 18, 2026
A
Verified Purchase
Anthony S
Port Orchard, US
★★★★★ 4
Cover too loose.
Size: 300A Fuse Holder
Nice looking, decent quality, versatile for different gauges. My only complaint with this holder is the cover doesn’t stay on very well, bought 3, and all 3 pop off easily, you will need to zip tie on.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 12, 2026
K
Verified Purchase
Kurtiss s.
Pawtucket, US
★★★★★ 5
Works as it should.
Size: 300A Fuse Holder
I’ve had several of these in my build for over a year now. Zero issues.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 3, 2025

recommand products