SKU: 1847941004

Human Plasminogen, His tag

Sale price$153.00 Regular price$170.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 12 - Jul 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Plasminogen, His tagProduct Specification Species Human Synonyms PLG Accession P00747 Amino Acid Sequence Protein sequence(P00747, Asn79 Pro466, with C 10*His)

Product Specification


Species Human
Synonyms PLG
Accession P00747
Amino Acid Sequence

Protein sequence(P00747, Asn79-Pro466, with C-10*His) NRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTEQLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAGLTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:45.7kDa Actual:65kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Plasminogen (former name profibrinolysin) is an inactive precursor of plasmin. It is a plasma protein that is part of the fibrinolytic system. Plasmin is an important enzyme (EC 3.4.21.7) present in blood that degrades many blood plasma proteins, including fibrin clots. In circulation, plasminogen adopts a closed, activation-resistant conformation. Upon binding to clots, or to the cell surface, plasminogen adopts an open form that can be converted into active plasmin by a variety of enzymes, including tissue plasminogen activator (tPA), urokinase plasminogen activator (uPA), kallikrein, and factor XII (Hageman factor). Plasmin deficiency may lead to thrombosis, as the clots are not adequately degraded. Plasminogen deficiency in mice leads to defective liver repair, defective wound healing, reproductive abnormalities.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 1847941004

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 1212 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
jenn_azhere
Chelsea, US
★★★★★ 4
book 3
Format: Kindle
This was a great read!! I love Dean and Allies story, the backstories that are implemented, and how much the characters grew. I did feel a little sorry for Sean even though I shouldn’t. The growth, spice, and story was a good read. Highly recommend! Now onto Tuckers story!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026
C
Verified Purchase
Cameron
Bozeman, US
★★★★★ 5
A must have for your summer bag
I am 100% devoted to Blue Lizard products! I got some extra sun and needed relief, fast. This non-greasy nor slimy cream is exactly what I didn’t know I was looking for. I had applied aloe alone to my skin and received no relief. Within minutes if not seconds of applying this, I had noticed improvement. The consistency is not too thick or too thin, it absorbs into the skin nicely and can be reapplied without getting cakey. It gave my sunburn relief while also moisturizing the skin. I haven’t peeled at ALL. I love that it has clean ingredients and a neutral fragrance. My skin is so sensitive, so having natural ingredients is a plus. Blue Lizard After Sun is now my holy grail and I will recommend it over and over.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 8, 2026
L
Verified Purchase
Laura
Boise, US
★★★★★ 5
HANDS. DOWN. AMAZING.
I have used other products for after sunning in the past. This stuff is AMAZING and I wish I could be a spokesperson for it. I am extremely fair skinned and used this on my vacation at the beach. I used some spf which always leaves me slightly red. I put this on every night and the redness was gone by morning! I was ready to hit the sun again! It doesn’t have a scent and doesn’t leave a sticky lingering feeling or weird smell either. Just moisturizing and safe for my acne prone skin. I will buy this and use this forever!!!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 5, 2026
D
Verified Purchase
drew
New York, US
★★★★★ 5
Phenomenal.
Got a baaaaad sunburn from head to toe. On day 2 or 3, I finally got this stuff. It took the sting away quickly. No smell, and it feels nice on the skin. It’s thin and spreads well. Definitely helped keep my burns moisturized - I didn’t even peel, save for the blisters on my shoulders. My boy even let me put it on his pink little cheek, and
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 3, 2026
J
Verified Purchase
Jenn D.
Grantham, US
★★★★★ 5
Miracle in a bottle!
This was a lifesaver, I got badly burnt just walking for several miles one day. It was only in the 80's, not 100 degree's but still hot. Where I live there is a poor air quality, too. I was red as a lobster! It was painful and then i saw this. Read the reviews and hoped it would help. Did it ever! It not only helped sooth my skin, calm it down, it dramatically reduced the redness in just a few days! I should have saved the photo's of the before a several days after, but I deleted them. (I wasn't thinking and they were kind of gross). They would have shown the extent of the healing thanks to this cream. I even had some blisters, that shrank in two days after applying this! By the fourth day of applying this cream, they were gone and my skin went from being deep red to pink. What is even more awesome is this moisturized my skin! I have sensitive skin and this did not irritate it. So that was a plus! My only issue was it's a little tacky, sticky after you apply it. So don't apply right before bed, unless you want to be stuck to your sheets. If you're in dire need of relief and to reduce the redness, this is what you want, it is a miracle in a bottle!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026

recommand products