SKU: 21951038540

Human PTH , His tag

$166.50 $185.00
Save 10%
No.2 Bestseller on chainsta.de >

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 12 - Jul 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human PTH , His tagProduct Specification Species Human Synonyms Parathormone, Parathyrin Accession P01270 Amino Acid Sequence Protein sequence(P01270, Ser32 Gln115, with C 10*His) SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQGGGGSHHHHHHHHHH Expression System CHO Molecular Weight Theoretical: 11. 1kDa Actual: 10, 12kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer

Product Specification


Species Human
Synonyms Parathormone, Parathyrin
Accession P01270
Amino Acid Sequence

Protein sequence(P01270, Ser32-Gln115, with C-10*His) SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQGGGGSHHHHHHHHHH
Expression System CHO
Molecular Weight Theoretical:11.1kDa Actual:10, 12kDa
Purity

＞95% by SDS-PAGE
Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Parathyroid hormone (PTH), also called parathormone or parathyrin, is a peptide hormone secreted by the parathyroid glands that regulates the serum calcium concentration through its effects on bone, kidney, and intestine. PTH influences bone remodeling, which is an ongoing process in which bone tissue is alternately resorbed and rebuilt over time. PTH is secreted in response to low blood serum calcium (Ca2+) levels. PTH indirectly stimulates osteoclast activity within the bone matrix (osteon), in an effort to release more ionic calcium (Ca2+) into the blood to elevate a low serum calcium level. Disorders that yield too little or too much PTH, such as hypoparathyroidism, hyperparathyroidism, and paraneoplastic syndromes can cause bone disease, hypocalcemia, and hypercalcemia.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 21951038540

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 1881 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
H
Verified Purchase
Honor Breining
Charlottesville, US
★★★★★ 5
Lightweight and soft
Color: Navy Blue Seersucker, Size: King(108"x90")
I purchased this as someone who is constantly waking up too hot with blankets, but too cold without. This comforter has been a game changer. I’m getting much better sleep, and while I still wake up a little too warm sometimes, it’s significantly less than I was previously.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 22, 2026
P
Patrizio
Houston, US
★★★★★ 5
ightweight Cooling Comforter That Actually Feels Good for Hot Nights
This seersucker cooling comforter has been a nice upgrade for warmer nights. It’s very lightweight and breathable, so it doesn’t feel heavy or trapping heat like a traditional comforter. The fabric has a soft, slightly silky feel, and the seersucker texture gives it a bit of airflow that helps it stay more comfortable. The fit is good on a Twin size bed with enough drape over the sides without feeling oversized or bulky. It lays nicely on the bed and doesn’t bunch up easily, which makes it easy to straighten out in the morning. Thickness-wise, it’s on the thinner side, which is actually what makes it work for hot sleepers. It’s not meant to be a heavy blanket and more of a light, breathable layer that still feels like a comforter. The reversible design is a nice touch too depending on which side you prefer. Overall, it’s easy to use, lightweight, and comfortable for summer or warm sleepers. It feels like good value if you want something simple that helps cut down on overheating without overcomplicating things.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 17, 2026
Y
Yolanda
Bozeman, US
★★★★★ 5
Cooling Blanket for Hot Sleepers, Soft Lightweight Comfort with a Cool-to-the-Touch Feel
This reversible cooling blanket is a great option for anyone who sleeps warm. It’s incredibly soft, very lightweight, and has that instantly cool-to-the-touch feel that makes it especially comfortable for hot sleepers. What I liked most is how airy and breathable it feels without being heavy or stuffy. It’s comfortable enough to use all night and gives that nice cooling sensation when you first pull it over you. The softness also makes it feel cozy without sacrificing the lightweight design. My only real wish is that it came with a matching pillowcase, because that would make it feel even more complete as a sleep set. Pros: Extremely soft and comfortable Cool to the touch Lightweight and airy feel Great for hot sleepers Breathable without feeling heavy Cons: Does not include a matching pillowcase Verdict: If you tend to sleep hot, this is a really nice lightweight cooling blanket. It’s soft, breathable, and comfortable with a refreshing cool feel. I just wish it included a pillowcase to make the set feel complete
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 4, 2026
B
Verified Purchase
Bata
Grantham, US
★★★★★ 4
Cool & comfy
Color: Dark Gray Seersucker, Size: King(108"x90")
Cool but not as cold as I wanted Very soft and comfy though
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 29, 2026
L
Lola D.
San Leandro, US
★★★★★ 5
Cooling Blanket is a sleep saver for me!
This is the second product I have used from bedsmile and as with the other one, this is a great product! It truly is a cooling blanket. I am a very hot sleeper and live in a hot, humid climate, so this has been a sleep saver for me! One side is silky smooth and feels so good on your skin. The other side has a texture to it which is great if you want to use it as your only bedding, which I do. It covers well and hangs over the edges as it should. I ordered the white one and it is bright and unblemished. The silky side magically feels much cooler than typical bedding and keeps me cooler during the night. It is lightweight but heavy enough to make you feel that you are "under the covers". In my opinion, putting additional covers over it would defeat the purpose but if you live in a cooler climate, it would still be beneficial to use this blanket as the silky coolness would help get a good night's sleep anywhere. Another great benefit of this product is that it does not have any strange odors when unpacking. I did wash it before using, but honestly, I am not sure it was necessary.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 20, 2026

recommand products

BOCCHI THE ROCK! theme, Eyegaze spacebar design, 6.25 U spacebar, PC crystal resin gilded personalized keycaps, anime creative cultural peripheral products, decorative keycaps
28.80
Lipstick Top
100.80
Belen
136.00
National Day special flower arrangement
136.00
Glam Sachet Kathina
10.00