Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 12 - Jul 17
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human CY211, His TagProduct Specification Species Human Synonyms Cy211 Accession P08727 Amino Acid Sequence Protein sequence(P08727, Ser239 Leu400 with C 10*His) SAPGTDLAKILSDMRSQYEVMAEQNRKDAEAWFTSRTEELNREVAGHTEQLQMSRSEVTDLRRTLQGLEIELQSQLSMKAALEDTLAETEARFGAQLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSRLEQEIATYRSLLEGQEDHYNNLSASKVLGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 20kDa Actual: 22kDa Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation
Product Specification
| Species | Human |
| Synonyms | Cy211 |
| Accession | P08727 |
| Amino Acid Sequence |
Protein sequence(P08727, Ser239-Leu400 with C-10*His)
|
| Expression System | HEK293 |
| Molecular Weight | Theoretical: 20kDa Actual: 22kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage |
12 months from date of receipt, -20 ℃ to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
Cytokeratin 19 fragment antigen (Cy211) belongs to a cytokeratin family, which is normally expressed in epithelial tissues and forms the epithelial cells’ filament cytoskeleton. Cy211 is useful as a tumor marker, especially for non-small cell lung cancer (NSCLC) along with carcinoembryonic antigen (CEA) and squamous cell carcinoma–associated antigen (SCC), but also for other epithelial tumors such as bladder cancer. This elevation in tumors may be due to cell lysis, releasing cell contents to the blood, including Cy211 by the action of proteases that degrade the cytokeratin filaments
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy