FABP3 His Tag Protein, Human
SKU: 3501838558

FABP3 His Tag Protein, Human

Sale price$162.00 Regular price$180.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 8 - Jul 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

FABP3 His Tag Protein, HumanProduct Specification Species Human Accession P05413 Amino Acid Sequence MHHHHHHVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA Expression System E. coli Molecular Weight 15. 7 kDa(Reducing) Purity 95%, by SDS PAGE under reducing conditions Endotoxin <2EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer PBS, pH7. 4

Product Specification


Species Human
Accession P05413
Amino Acid Sequence MHHHHHHVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA
Expression System E.coli
Molecular Weight 15.7 kDa(Reducing)
Purity

95%,  by SDS-PAGE under reducing conditions

Endotoxin <2EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Fatty acid-binding protein 3 (FABP3) is a cytosolic protein found in various tissues, including heart, skeletal muscle, intestinal mucosa, liver, and kidney. It is also highly expressed in the adult brain, particularly in the pons, frontal lobe, and hippocampus. In the brain, FABP3 regulates the lipid composition of the membrane and transports fatty acids between different intracellular compartments. It is released extracellularly after neuronal damage and high cerebrospinal fluid (CSF) concentration of FABP3 is found in acute conditions, such as brain injury and stroke. CSF FABP3 concentration is also higher in conditions with neuro degeneration/neuronal damage, e.g., Alzheimer’s disease (AD), mild cognitive impairment (MCI) due to AD, dementia with Lewy bodies, and Creutzfeldt–Jakob disease. CSF FABP3 concentration correlates with cognitive decline and are associated with brain volume loss in areas selectively affected in early AD. Thus, FABP3 is suggested to be a general marker of neuronal damage.

 

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 3501838558

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 1730 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
The Beauty Chronicles
Lake Worth, US
★★★★★ 5
MICRONEEDLING IS MY SKIN’S SECRET WEAPON!!!
Microneedling completely transformed my skin. Of every treatment I have ever tried, this one has made the biggest difference in texture, glow, and overall refinement. After years of paying for appointments, I decided to learn proper technique and invest in a Dr. Pen device for at home use, and I truly have never looked back. Needle Options and Coverage: I typically use a 16 pin cartridge, so I am excited to incorporate the 36 pin into my routine. The wider pin configuration allows for broader coverage, which makes it especially useful for larger areas of the face and even the body. It gives me more versatility in my treatments. Compatibility and Value: It is such a relief to find cartridges that are compatible with my Dr. Pen device right here on Amazon. The price point is very reasonable, especially compared to professional treatment costs. Having reliable, accessible replacements makes maintaining my routine so much easier. Excellent value for the money. Final Thoughts: Convenient, affordable, and a great addition to my microneedling routine… I love having professional level tools within reach… and my skin continues to thank me for it…
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 20, 2026
M
Me
Pawtucket, US
★★★★★ 5
A long, HONEST & detail filled review (with usage tips) from a skincare junkie.
These cartridges arrived super fast (with enough time to spare for a quick face sesh before the holidays!). The lot of 12 was packed in a cellophane/paper bag (the basic, unlabeled sterilization bags) that was sealed shut. The cartridges themselves are all separately packaged (in smaller plastic/paper sterilization bags), each one was properly sealed shut, ensuring sterilization. The individual bags have an illustration of the cartridge and are labeled as “36 NEEDLE” . There are photos of and all the different size needle patterns as well. Each package contains a proper lot #, manufacture date (10/10/25) and expiration date (10/09/2028) along with the info that the disposable tips were sterilized with non-pyrogen EO Gas. Not a single package was damaged or open and all contained the proper cartridge inside. I was VERY happy when I removed one of the cartridges and saw that it (they all) have the protective cap/cover inside the tube/over the needles. Not only is that more sanitary and keeps the needles protected in the event the spring is pushed, but it's also a dead giveaway for spotting bad/bootleg cartridges (as they typically don't come with the cap). While these might not be brand name, they definitely aren't bootleg quality! These are nearly identical to the cartridges I order directly from Dr. Pen. They are the same size and shape, with the color of the plastic tubing being the only slight difference. The 36 needle pattern is legit, with the long row of 10 needles in the center, a row above and below that with 8 needles and the rows on the top and bottom containing 5 needles each. They are perfectly spaced and staggered. The cartridges fit my M7S perfect- nice and snug with no wiggling or looseness. The silicone membrane keeps your pen clean and hygienic and the spring system provides smooth, continuous movement without the needles getting stuck or punching jerky. The needles themselves are very fine and they are nice and sharp. I am extremely sensitive to anything other than medical grade stainless or titanium (I know immediately when I'm using something that's not that!) and I haven't had a single issue with these. Considering 10 brand name cartridges are $40, getting 12 of these that look and function almost identically for $25 is a steal. With no minimum spend for shipping and quick arrival time, I know I'll be buying these again! ⭐️TIPS FOR USING THE 36 NEEDLE CARTRIDGES⭐️ These cartridges are perfect for wrinkles and fine lines, large pores, pigmentation, increasing firmness as well as hydration (after using these, your products sink deep down in the skin- quick. It's great!). *For lines and wrinkles on the face and neck, you want a depth of 1.5 - 2.0mm (with a max of 1.5 for the glabellar lines or the 11's). For wrinkles around the lips, 0.5 - 1.5mm *If you are working on your pores, 0.5 - 1.0mm depth *Uneven pigmentation, 0.5 - 1.5mm depth and 1.0 - 2.0mm depth for sun spots specifically. *For firmer, tighter skin and skin laxity, 1.5 - 2.0mm These are just some general depth guidelines I use with these cartridges. I am not an aesthetician, but I am a total skincare junkie that has been microneedling myself for the past 15 years. As always, do your own research, especially because different areas around the face may require a shallower depth. If you are uncomfortable, then adjust the depth for your comfort. Finally, remember to clean your skin, hands and pen throughly before microneedling and work in a clean environment too. You don't want to introduce any bacteria or germs 2mm down (or even .5mm down) in your dermis. Also, these are single use cartridges and they are very affordable, so don't try to clean and reuse them (that's just asking for trouble!) Instead, toss and replace!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 23, 2025
I
Verified Purchase
Iviana Beauty
Los Angeles, US
★★★★★ 1
No es para Dr Pen M8
No le sirve al Dr Pen M8
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 19, 2026
C
Customer review
Houston, US
★★★★★ 5
For larger size areas
Top quality with stainless steel material. Using 36 pins which sturdy pins. It fits well on M8 and easy to use. Because of the size it works a bit tougher/ harder providing deeper penetration. Because of the amount of pins these are for larger sized areas leaving this more for moderate to experts to be able to use this efficiently and effectively. Good value for the money
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 13, 2026
E
Esbe Hennessy
Massapequa, US
★★★★★ 5
Works just as well as the OG, but for much less
This is a perfect and less costly way to get microneedling cartridges for my Dr. Pen M8. They fit perfectly and work just as well. They come with all kinds of precautions taken to keep them sterile, which is very important with something meant to reach down into your skin. The pins are just like the originals and honestly I can't feel any difference when using it. There's no need to pay more for name brand when these work just as well. I'm always a bit cautious because so many off brands aren't just cheap in price, but in quality. Not these, they're the real deal. You can save money and get replacement cartridges that will do a great job.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 28, 2025

recommand products