SKU: 43358953760

Human Calprotectin(S100A8), His tag

Sale price$90.00 Regular price$100.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 12 - Jul 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Calprotectin(S100A8), His tagProduct Specification Species Human Synonyms Calgranulin A; Calprotectin L1L subunit; Cystic fibrosis antigen (CFAG); Leukocyte L1 complex light chain; Migration inhibitory factor related protein 8 (MRP 8; p8); Urinary stone protein band A; CAGA Accession P05109 Amino Acid Sequence Protein sequence(P05109, Met1 Glu93, with C 10*His) MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKEGGGGSHHHHHHHHHH Expression

Product Specification


Species Human
Synonyms Calgranulin-A; Calprotectin L1L subunit; Cystic fibrosis antigen (CFAG); Leukocyte L1 complex light chain; Migration inhibitory factor-related protein 8 (MRP-8; p8); Urinary stone protein band A; CAGA
Accession P05109
Amino Acid Sequence

Protein sequence(P05109, Met1-Glu93, with C-10*His)
MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKEGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Predicted MW: 12.5 kDa Observed MW: 13.0 kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

S100A8 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. Altered expression of this protein is associated with the disease cystic fibrosis and post COVID-19 condition.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 43358953760

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 227 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
Verified Purchase
TLBMorgan
Fort Morgan, US
★★★★★ 5
My boy loves it!
Color: Red, Size: Medium, Color: Red, Size: Medium
This is my frenchies new favorite toy!! He loves the sounds and it seems very durable. Would recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 11, 2026
M
Verified Purchase
MGW
Grantham, US
★★★★★ 5
Wonderful toy, but for most dogs it's a toy you play WITH dog, not a chewie
Color: Red, Size: Medium, Color: Red, Size: Medium
I'm a dog trainer, and have shared my life with many dogs. For the current mini aussie, toys are a necessity and a lifeline. He is tough on toys, and we have certainly tossed many many MANY ruined toys. This toy is wonderful: the squeak is fabulous, it bounces great, it's easy to carry around, and great for fetch and a little tug. Love it, and so does he. But it's soft rubber, so it's a toy to be played JOINTLY with... not a chewie. It will create a lot of fun times and silly entertainment and exercise, but I will put it away when I am not closely monitoring and involved with the play. One of the photos is blurry but shows that the rubber is soft.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 9, 2026
A
Verified Purchase
Andrew
West Palm Beach, US
★★★★★ 3
Stops giggling after a few weeks
Color: Red, Size: Medium
I have bought three of these Giggler toys. The dogs absolutely LOVE this giggler toy and it's irresistible to them, even more so than squeaky toys. The rubber is soft and flexible, and after weeks of tug-o-war between dogs, the rubber has stood up well and is showing no sign of breakage. However in two of the toys, the giggler mechanism has started to fail and barely makes any noise at all. The dogs have lost interest in them.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 15, 2024
A
Verified Purchase
Amazon Customer
Grantham, US
★★★★★ 5
A winner!
Color: Red, Size: Medium
Our pembroke welsh corgi’s favorite toy. We ended up getting him a second one. One for inside. The other, outside. Great for tug-a-war, fetch, and just chewing on. I can recommend this all day long.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 3, 2026
A
Verified Purchase
Amanda
Natrona Heights, US
★★★★★ 5
Perfect Pup Pal
Color: Green
I purchased this dog toy as a birthday gift for a friend's dog, and it exceeded all expectations. Knowing she is particular about toys and easily frightened by many, I spent quite some time choosing the perfect one. From the moment she took it out of the box, she adored it. Everyone at her birthday party was amazed. Watching her happily play with her new toy, which we've come to call Allie, is truly heartwarming. The quality is outstanding. It is well made, safe, and nearly indestructible, yet gentle enough on her mouth. I will definitely be buying more from this store.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 16, 2026

recommand products