Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 9 - Jul 14
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Rhesus macaque TNFSF15 Protein, His TagProduct Specification Species Rhesus macaque Synonyms Tumor necrosis factor ligand superfamily member 15, TNF ligand related molecule 1, Vascular endothelial cell growth inhibitor, TNLG1B Accession F6S8F9 Amino Acid Sequence Protein sequence (F6S8F9, Leu72 Leu251, with N His Tag)
Product Specification
| Species | Rhesus macaque |
| Synonyms | Tumor necrosis factor ligand superfamily member 15, TNF ligand-related molecule 1, Vascular endothelial cell growth inhibitor, TNLG1B |
| Accession | F6S8F9 |
| Amino Acid Sequence | Protein sequence (F6S8F9, Leu72-Leu251, with N-His Tag) LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHLKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFVYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL |
| Expression System | HEK293 |
| Molecular Weight | Predicted MW: 22.1 kDa Observed MW: 25-30 kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Physical Appearance | Lyophilized powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. |
Background
TNFSF15 (Tumor Necrosis Factor Superfamily Member 15), also known as TL1A, is a cytokine that binds to death receptor 3 (DR3) and decoy receptor 3 (DcR3). It plays a key role in modulating immune responses, particularly in T-cell activation, inflammation, and autoimmune diseases. TNFSF15 is highly expressed in endothelial cells and contributes to angiogenesis and vascular remodeling. Dysregulation of TNFSF15 is linked to inflammatory disorders (e.g., Crohn’s disease, rheumatoid arthritis) and cancers. Its dual role in pro-inflammatory and anti-angiogenic signaling makes it a potential therapeutic target for immune-mediated and vascular diseases.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy