Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 12 - Jul 17
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human CD16b, His tagProduct Specification Species Human Synonyms Low affinity immunoglobulin gamma Fc region receptor III B, Fc gamma RIII beta, FcR 10, IgG Fc receptor III 1, FCGR3B, FCG3, FCGR3, IGFR3 Accession O75015 Amino Acid Sequence Protein sequence(O75015, Gly17 Ser200, with C 10*His)
Product Specification
| Species | Human |
| Synonyms | Low affinity immunoglobulin gamma Fc region receptor III-B, Fc-gamma RIII-beta, FcR-10, IgG Fc receptor III-1, FCGR3B, FCG3, FCGR3, IGFR3 |
| Accession | O75015 |
| Amino Acid Sequence | Protein sequence(O75015, Gly17-Ser200, with C-10*His) GMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISGGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | Theoretical:22.5kDa Actual:35-50kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
CD16, also known as FcγRIII, is a cluster of differentiation molecule found on the surface of natural killer cells, neutrophils, monocytes, macrophages, and certain T cells. CD16 has been identified as Fc receptors FcγRIIIa (CD16a) and FcγRIIIb (CD16b), which participate in signal transduction. The most well-researched membrane receptor implicated in triggering lysis by NK cells, CD16 is a molecule of the immunoglobulin superfamily (IgSF) involved in antibody-dependent cellular cytotoxicity (ADCC). It can be used to isolate populations of specific immune cells through fluorescent-activated cell sorting (FACS) or magnetic-activated cell sorting, using antibodies directed towards CD16.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.8 ★★★★★
Based on 1310 reviews
Sort
Product Reviews
★★★★★ 5
Reliable and Dependable
Color: Blue
The LIANXIN Roadside Assistance Emergency Kit is a solid, thoughtfully assembled kit that every car owner should consider keeping in their trunk. It covers all the basics you’d want in an unexpected roadside situation and does so in a compact, well-organized package.
The tools feel sturdy and practical rather than cheap or disposable. Items like the jumper cables, reflective safety vest, warning triangle, and flashlight are especially useful and inspire confidence in an actual emergency. Everything fits neatly into the carrying case, making it easy to store without taking up much space.
What really stands out is the kit’s versatility—it’s suitable for daily commuters, long road trips, and even new or inexperienced drivers who want extra reassurance. It’s also a great gift idea for students, new drivers, or anyone who wants to be better prepared on the road.
Overall, the LIANXIN Roadside Assistance Emergency Kit delivers excellent value for its price. It’s practical, reliable, and provides real peace of mind knowing you’re prepared if something goes wrong. Highly recommended for any vehicle owner. 🚗🧰
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 8, 2026
★★★★★ 5
Worth every single penny.
Color: gray
I haven’t had this kit in my car for very long, but it has definitely come in handy. Especially when people leave their blown out tires in the middle of the interstate and you accidentally run it over because the traffic is so bad you can’t see it coming and it knocks the plastic protectant piece loose from under your car and starts making an awful sound because it’s being dragged across the ground on the interstate. I pulled over and used one of the zip ties in this kit to hold it up and it’s still holding it up quite nicely I might add. This is something definitely worth having around because you never know what may come your way in life.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 18, 2025
★★★★★ 4
Great Emergency car kit equipments
Color: Black, Color: Black
I bought the used/resale price at $33 instead of $48 new price. Nothing actually looked used. Most of the items are of great quality! - was actually surprised. Get this if you're looking for a budget friendly roadside emergency car kit with multiple useful items with great quality.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 15, 2026
★★★★★ 5
Great emergency kit for the car
Color: Blue
This roadside emergency kit is very useful to keep in the car. It comes with many important items for unexpected situations, feels well organized, and gives extra peace of mind while driving.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
★★★★★ 5
Nice gift
Color: Blue
New driver in the family so this was a decent gift for the price
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 24, 2026
recommand products
Sabian 21402XCB AAX Medium BR Hats -14"
262.50
Sabian 21885XB AAX X-Plosion Fast Crash Cymbal - 18"
187.00
40, White-d'Or, City With Number, Women's Short Sleeve Round White T-shirt 00008
20.00
Woodbridge Wolfpack Core Cotton Tee
22.95
Custom Light Blue Red-Gray Authentic Split Fashion Baseball Jersey
29.99