CEACAM-5/CD66e His Tag Protein, Human
SKU: 70840101736

CEACAM-5/CD66e His Tag Protein, Human

Sale price$234.00 Regular price$260.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 8 - Jul 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CEACAM-5/CD66e His Tag Protein, HumanProduct Specification Species Human Synonyms CEACAM 5, CD66e, CEA, Meconium antigen 100 Accession P06731 Amino Acid Sequence Lys35 Ala685, with C terminal 10*His

Product Specification


Species Human
Synonyms CEACAM-5, CD66e, CEA, Meconium antigen 100
Accession P06731
Amino Acid Sequence

Lys35-Ala685, with C-terminal 10*His KLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGGGSGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight

95-150kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer

PBS, pH7.4

Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Reference

1、Hammarstrom S. (1999). The carcinoembryonic antigen (CEA) family: structures, suggested functions and expression in normal and malignant tissues. Seminars in Cancer Biology. 9(2): 67-81.

Background

The human CEA family has been fully characterized. It comprises 29 genes of which 18 are expressed; 7 belonging to the CEA subgroup and 11 to the pregnancy specific glycoprotein subgroup. CEA is an important tumor marker for colorectal and some other carcinomas. The CEA subgroup members are cell membrane associated and show a complex expression pattern in normal and cancerous tissues with notably CEA showing a selective epithelial expression. Several CEA subgroup members possess cell adhesion properties and the primordial member, biliary glycoprotein, seems to function in signal transduction or regulation of signal transduction possibly in association with other CEA sub-family members.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 70840101736

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 331 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
Verified Purchase
Tracy Y.
Belleville, US
★★★★★ 5
Parents of HS Students: READ THIS BOOK!
Format: Hardcover
A must-read book for parents navigating the "IVY OR BUST" aspirations of all top-performing high school students. Families simply can not afford the near-100K/year tuition for these institutions. It's unsustainable, and adding soul-crushing debt (before a career is even begun!) is not what parents want for our students. Enter Dream School: a guide to finding YOUR student's opportunity (and less expensive education) amid the noise and rah-rah of aggressive college recruiting. The book is a fast, comprehensive read which gives parents guidance and "permission" to consider schools with less name recognition/lower cost, but with high performance teaching and reasonable return on investment (ROI.) Remember the goal: a college degree for a happy, fulfilled student ready to enter the job market or grad school.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 12, 2025
T
Verified Purchase
traceyj1234
Lexington, US
★★★★★ 5
More than one way to a quality education
Format: Hardcover
As a high school counselor, I watch students and parents driving teens to the brink of exhaustion trying to get into the "right" school. I will not deny that there are some benefits to certain highly selective schools, but the issue is that very few do get in there, even if they are capable, and then what? Students think their future will not be as bright or that they will have fewer opportunities, and this book debunks that idea with research and sound principles. Finding a school that works with your strengths, your goals, and your budget is paramount today, and the very best way to create a future that brings fulfillment. Well-written and researched, this book should be reassurance for parents and students that there are many schools that can provide quality education and opportunities for our young people.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 11, 2025
D
Verified Purchase
DL
Birmingham, US
★★★★★ 5
Permission to Help My Child Find Joy
Format: Hardcover
As a parent starting the college search process, I've really come to appreciate Jeff's insights in his previous books, podcast and newsletter. So pleased to finally have this book at my disposal, and less than a month in, it's already dog-eared and marked up! Like most parents out there, I'm fighting my own internal inertia to align my child's accomplishments against the "metrics" (real or imagined) of admission, and gravitating towards the big names. If you are in that stage, I'll say from personal experience that now is a great time to pick up this book. It's a quick read (for someone who's not a "reader"), and it plants the right questions and data in your head to open your perspective. Its funny, every good parent I know just wants their kid to be happy, to find their joy in life. When it comes down to it, our only equating of big name to their happiness comes a derivation that success brings happiness, and big school brings success. As Jeff suggests, this book doesn't say DON'T seek the big name... It just gives permission to look more broadly, that the same success, and perhaps even greater happiness, can be found elsewhere. Now we just need need to make sure our kids see that too, and they are empowered to seek their joy with our full support. There is still data in here that confirms name schools do convey certain advantages. Whether those advantages align with a child's success and happiness is the question we can chase in this process. I, for one, really appreciate Jeff's efforts to make the case for the broader search and taking the time to do it with excellent, fresh analysis of the data in hand. Maybe this book and others generate the momentum to continuing these unique data streams to break the US News/Naviance overload of the process. Good luck to everyone in a similar boat, and I hope you find this as useful a reference as I did.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 22, 2025
U
Verified Purchase
Udo F
Draper, US
★★★★★ 4
Good Book!
Format: Hardcover
Pretty insightful book! I don't read college books too often but Selingo has very very good ideas that can easily transfer to college.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 14, 2026
L
Verified Purchase
Lauren Feltner
Lowell, US
★★★★★ 5
Great read to start on the college search journey
Format: Hardcover
Highly recommend for high school parents and students!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 19, 2026

recommand products