IL-13 Protein, Cynomolgus
SKU: 95621400

IL-13 Protein, Cynomolgus

Sale price$162.00 Regular price$180.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 9 - Jul 14

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

IL-13 Protein, CynomolgusProduct Specification Species Cynomolgus Synonyms ALRH, BHR1, MGC116786, MGC116788, MGC116789, P600, Interleukin 13 Accession Q0PW92 Amino Acid Sequence Ser21 Asn132, with N terminal 8*His HHHHHHHHGGGSSPVPPSTALKELIEELVNITQNQKAPLCNGSMVWSINLTAGVYCAALESLINVSGCSAIEKTQRMLNGFCPHKVSAGQFSSLRVRDTKIEVAQFVKDLLVHLKKLFREGQFN Expression System HEK293 Molecular Weight 25 40kDa Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical

Product Specification


Species Cynomolgus
Synonyms ALRH, BHR1, MGC116786, MGC116788, MGC116789, P600, Interleukin-13
Accession Q0PW92
Amino Acid Sequence

Ser21-Asn132, with N-terminal 8*His HHHHHHHHGGGSSPVPPSTALKELIEELVNITQNQKAPLCNGSMVWSINLTAGVYCAALESLINVSGCSAIEKTQRMLNGFCPHKVSAGQFSSLRVRDTKIEVAQFVKDLLVHLKKLFREGQFN

Expression System HEK293
Molecular Weight

25-40kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer

PBS, pH7.4

Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Reference

1. Comparative Study Protein Expr Purif . 1998 Mar;12(2):239-48.

Background

Interleukin-13 is a cytokine which is secreted by activated T lymphocytes and primarily impacts monocytes, macrophages, and B cells. Interleukin 13 is a single-chain glycosylated polypeptide, which belongs to the IL-13/IL-4 family. IL-13 induces its effects through a multi-subunit receptor that includes the alpha chain of the IL-4 receptor (IL-4Rα) and at least one of two known IL-13-specific binding chains. Recent studies have shown that human interleukin-13 has many structural similarities with human interleukin-4 and is produced by gene replication events. As a cytokine, IL-13 protein is critical in regulating inflammatory, immune responses, and diseases.Also, it inhibits the production of pro-inflammatory cytokines and chemokines, and thus down-regulates macrophage activity.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 95621400

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 601 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Jennie_reader
Louisville, US
★★★★★ 5
The 1st one is better than this one but I still love it
Format: Kindle
The Mistake is the second book in Elle Kennedy’s Off-Campus series, following a new couple while maintaining the humor, steamy romance, and emotional depth that made The Deal so popular. This installment focuses on Logan, Garrett’s best friend and fellow hockey player, and Grace, a quiet but strong-willed freshman, as they navigate second chances and personal growth. John Logan – Logan is charming, funny, and a ladies' man, but beneath his confident exterior, he struggles with deep-seated family issues and a sense of being trapped by his circumstances. His development throughout the book makes him more than just the stereotypical player. Grace Ivers – A freshman who starts off shy but proves to be independent and assertive. She isn’t easily won over, and her ability to stand her ground makes her a refreshing and likable heroine. Familiar faces from The Deal, including Garrett and Hannah, return, while new side characters add to the college setting’s energy and humor. Kennedy’s writing is engaging, with a mix of humor, emotional moments, and steamy romance. The alternating perspectives between Logan and Grace allow for a well-rounded view of their relationship and personal struggles. The book delivers plenty of humor and flirty banter while also tackling deeper themes of family responsibility, self-worth, and making tough life choices. The chemistry between Logan and Grace is strong, and their romance is a blend of fun, tension, and genuine emotional connection. Strengths ✔ Strong Character Growth – Both Logan and Grace undergo realistic, satisfying development. ✔ Second-Chance Romance Done Right – Logan’s journey to making up for his mistake feels earned, and Grace doesn’t immediately forgive him, which adds authenticity. ✔ Engaging Writing & Humor – The witty dialogue and college setting keep the story entertaining. ✔ Balanced Romance & Personal Struggles – The love story is front and center, but each character also has their own challenges to overcome. The Mistake is a fun, emotional, and steamy addition to the Off-Campus series. While it follows a familiar formula, the engaging characters and well-paced romance make it a standout. Fans of The Deal and other college sports romances like The Chase by Elle Kennedy or The Score (book 3 in the series) will love this one.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 16, 2025
S
Verified Purchase
shellbelle
Phoenix, US
★★★★★ 5
I loved everything about The Deal by Elle Kennedy!
Format: Kindle
I have been a huge fan of Elle Kennedy’s writing for years. I loved her Out of Uniform series and Killer Instincts series. Her After Hours series is sizzling hot. She has a way of bringing her characters to life and making them demand your absolute attention. Her books have a combination of witty dialogue, dynamic characters, a well developed plot, and pacing that keeps the reader enthralled. Most of her books have either been erotic romance or romantic suspense. I was wondering how she would pull off a New Adult romance. New Adult romance is a generalized genre that can contain sweet & sexy, dark & intense, angsty & anxious, or exciting & erotic. The Deal has all of these elements and more. It is one of the most enjoyable and entertaining New Adult romances that I have read. I connected with the main characters as well as the secondary characters. They were all larger than life in their own way. The one thing that stood out besides the main characters romance was Elle’s portrayal of college life. She portrayed a very realistic look at life on the college campus and how it relates to their courses as well as social life. Garrett Graham is the bad boy of the college hockey team. He makes panties melt and owns his man whore reputation with relish. He has an overinflated ego that matches his cocky attitude. He is a star player and lives for playing hockey. He is diligent with his grades, practices, and performance. When he fails his philosophy mid term, it could not only ruin his GPA, it will affect his position on the team. He could lose the one thing he lives for. He is going to have to retake his philosophy mid term and ace it in order to remain on the team. He needs help. Who better to help him than one of the few students that managed not only to pass the mid term but ace it. He never really noticed Hannah Wells before until she accidentally dropped her exam and he saw her A. Now he is on a mission to get Hannah to tutor him. He will try to bribe her, entice her, and woo her. When he discovers the golden carrot that will make her give in, he will dangle it in every way he can. His life is counting on that golden carrot. Hannah Wells is a music major. She is a pretty confident and outgoing girl with her friends and peers. She is smart, personable, and resilient. She is dedicated to her craft. The one area she lacks in is her confidence with the opposite sex. She has finally found a guy that she is interested in and she has no clue how to deal with her attraction. Not only is he out of her league, he is also the star quarterback on the football team. Not the type of guy she would normally take an in interest in. She has had some very bad experiences with the opposite sex. Although she has mostly overcome her issues, she is still a bit leery and scared. If she can get past her fears, she may be able to approach him. When the ego maniac sex god, Garrett Grant, approaches her to tutor him in philosophy, she thinks he is out of his ever loving mind. There is no way she is going to tutor the self absorbed jock. That is until he finds out her ultimate weakness and offers her a guaranteed solution. His persistence and golden carrot are enough to make her cave. It’s time to make a deal with the Devil. Hannah and Garrett are in for some big surprises. They are both quite different than they appear on the surface. Hannah may have the upper hand when the tutoring begins but Garrett will quickly take control of the situation. Both will be in for a great learning experience. Both will come out winners in the end. Their Deal will seal both their fates. I loved the banter between Garrett and Hannah. The snarky sarcasm, witty comebacks, and dirty talking are beyond clever and entertaining. The heated bedroom scenes make your temperature burn out of control. The emotional and intimate moments will have you swooning. What I loved best is how they formed a deep respect and friendship with one another. They were able to honestly confide in one another and know that their trust was not misplaced. I loved everything about this book! Read The Deal by Elle Kennedy. I am looking forward to the next book in the Off-Campus series. The Mistake will release in June of 2015. It is a complete mystery of who this book will feature or what their story is about.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 23, 2015
T
Verified Purchase
Tori
San Leandro, US
★★★★★ 4
A Beloved College Romance That Earns Its Hype.
Format: Kindle, Format: Kindle
The Deal by Elle Kennedy is a college romance that fully delivers on its reputation. With engaging characters, steady emotional growth, and a relationship that develops naturally, it’s easy to see why this book remains so popular. The story follows Hannah Wells, a focused and reserved music student, and Garrett Graham, the confident captain of the college hockey team whose academic struggles threaten his future. When their paths cross through an unexpected agreement, a friendship begins that gradually deepens into something more meaningful. One of the book’s greatest strengths is its pacing. The relationship doesn’t rush or rely on instant attraction alone. Instead, it builds through shared experiences, honest conversations, and growing trust. This approach makes the connection between the characters feel believable and emotionally grounded. Both Hannah and Garrett face personal challenges that shape their decisions and growth throughout the story. These elements add depth without overwhelming the romance, keeping the focus on character development and mutual support. The dialogue is lively, the humour is well-placed, and the emotional moments are balanced with lighter scenes that keep the story moving. While some plot elements may feel familiar to readers of the genre, the overall execution is strong. The conflicts fit naturally within the story, and the resolution is satisfying without feeling overextended. The Deal is an enjoyable, well-written romance that blends heart, humour, and character-driven storytelling. A solid choice for readers who enjoy college settings, slow-burn relationships, and emotionally engaging narratives.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 18, 2026
K
Verified Purchase
Kunauntubbee
Belleville, US
★★★★★ 5
Hot, Sweet, and Real
Format: Kindle
First I love a hockey romance! Add in fake dating, he falls first, and shared trauma and you have me hooked! This has been on my TBR longer than I want to admit! With the show that came out I wanted to read this first and it did not disappoint! I loved it! Garret and Hannah together crack me up and are so cute! This book had sad, funny, serious, and spicy moments! Highly recommend! The audiobook voice actors did a good job! I would recommend reading the trigger warning page this book does talk about some issues/trama that can be triggering.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026
K
Verified Purchase
Katlyn
Draper, US
★★★★★ 5
Making my love for hockey (and the players) stronger
Format: Kindle
She manages to create such realistic characters that readers can’t help fall in love with. The Deal is no. exception to that. This book is actually our first introduction to her amazing world of obscenely attractive and crazy talented hockey players at Briar University. Wasting no time, we get straight to the wonderful and hot captain, Garrett Graham. Garrett is a history major in his third year at Briar. Here is where Ms. Kennedy does something different, in shows, movies, and books we often see teachers and professors cutting slack for athletes especially ones that are currently in season. Yeah no, that’s not the case at Briar. Enter: Hannah Wells. If I am being technical, we start of in her perspective however I’m in love with Garrett, so we ignore that. The two of them are taking some sort of philosophical ethics course and when the story kicks off, they are getting their midterms back. You ever have that teacher that literally has either way two high of standards, can’t teach or both? I don’t know what the case is in this situation, but the majority of the class bombs that midterm, except for Hannah (and a few other students). Garrett is among those who failed however he is majorly screwed because if he doesn’t ace this makeup, he is no longer academically eligible for sports. After literally bumping into Hannah on his way out of the lecture hall, he sees her grade and decides that this girl will be his tutor and he won’t take no for an answer. He is relentless in his pursuit of her tutoring him that he goes so far as showing up at her work to beg. Finally, he finds the one thing he can offer to make her say yes: a fake date to catch another guy’s attention. Yeah, that fun cliché. She agrees to tutor him only through the retake because she is too focused on her winter showcase for the music department to tutor him all semester. Predictably speaking, that whole fake dating thing, yeah that backfires. I wonder sometimes if it ever works in any way other than making one of the two people realize they have feelings for each other. Believe it or not though my favorite part of the book wasn’t the romance aspects of it. Yes, I thoroughly enjoyed that don’t get me wrong. It was the way that Hannah and Garrett actually became friends and spent time together as friends outside of studying and trying to get her crush’s attention. They binged Breaking bad, watched stupid documentaries and she hung out with the rest of the team celebrating one of their birthdays. This is something that in my opinion gets missed a lot in romance is that if two people are friends and fake dating, we want to see them actually being friends and not just a couple. Her characters are also so real. Like yes there’s no way this many perfect men exist for her to write 9 books about the hockey players that come through Briar. But that’s not what I mean, I mean her characters have substance to them, they have this wonderful thing that we all as real people have: past traumas. That being said, if you are a person that gets triggered by characters having been abused or sexually assaulted in the past, please consider this your trigger warning. This did all happen prior to the books first page so what we see is the aftermath of the traumas and not the actual events taking place if that makes any difference. If that is you, I would urge you to reconsider reading the story and the rest of this review because I do intend on discussing a little bit of what happens with those situations and how Garrett and Hannah chose to respond to them. Consider this also your spoiler alert as well. When Hannah was 15, she went to a party with friends. At this party she was drugged and raped. Now, roughly 6 years later, we see how this has affected her. She refuses to drink if she is not alone and has some problems with intimacy. The cool thing though is that she uses her friendship with Garrett to help her slowly work through these problems. Once he relatively knows what her hang ups are Garrett never once pressures her or belittles her for them only helping her to slowly move past them in any way he can even if it means he plays the “bodyguard” for a night out with their friends so she can drink and not feel scared. And of course, because this is a romance novel and those two are clearly meant to be he also helps her work through her problems with sex in such a slow and patient way that, in combination with everything else we’ve seen from him, makes all the sense in the world why he is loved not only by her (though she is too dumb to admit it till later) and by all of us as readers. Garrett’s past is not all sunshine and roses either. Son of a former NHL superstar, he had to watch his mother slowly die of cancer and watch as his father’s anger was directed in the form of physical violence at his mother, and later at him. Garrett was routinely abused by his father for years until he learned to hit back, no one saw any warning signs or stepped in ever. All they saw was a retired famous athlete and his equally athletically gifted son. Hannah is the first person he ever felt comfortable opening up to about this and is there for him as a place of support when he is essentially forced to spend thanksgiving with his father and his new girlfriend. She does whatever she can to support him and to remind him that no matter who your parents are, it doesn’t determine who you will be when you are older. This is such an important message that honestly everyone needs to hear as do many of the other men in this series just for different reasons than Garrett. This book is honestly in my opinion perfect, and I don’t think I’ve stopped recommending it to people since the first time I finished it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 30, 2022

recommand products