Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 12 - Jul 17
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human NY-BR-1, His tagProduct Specification Species Human Synonyms ANKRD30A Accession Q9BXX3 Amino Acid Sequence Protein sequence(Q9BXX3, Arg851 Leu928, with C 10*His) RMKVSIPTKALELMDMQTFKAEPPEKPSAFEPAIEMQKSVPNKALELKNEQTLRADQMFPSESKQKKVEENSWDSESLGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 10. 6kDa Actual: 13 20kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer Lyophilized from a 0. 2 m
Product Specification
| Species | Human |
| Synonyms | ANKRD30A |
| Accession | Q9BXX3 |
| Amino Acid Sequence | Protein sequence(Q9BXX3, Arg851-Leu928, with C-10*His) RMKVSIPTKALELMDMQTFKAEPPEKPSAFEPAIEMQKSVPNKALELKNEQTLRADQMFPSESKQKKVEENSWDSESLGGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | Theoretical:10.6kDa Actual:13-20kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
ANKRD30A has been previously identified as NY-BR-1 or antigen B726P. It was identified based on spontaneous humoural immune responses in breast cancer patients (Jäger et al. 2001, 2002). The protein is regarded as a putative transcription factor, as it contains a bipartite nuclear localization signal motif and a bZIP site (DNA-binding site followed by leucine zipper motif). Additional structural features include five tandem ankyrin repeats, implying a role for ANKRD30A in protein–protein interactions. In view of its highly restricted expression pattern, ANKRD30A may be considered as a breast differentiation antigen that could represent a suitable target for immunotherapy. Indeed, it was found in 80% of breast cancer specimens, while tumours of other histological types were ANKRD30A-negative. It was also identified in normal breast, normal testis, was inconsistent in prostate, and not found in other tissues.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.0 ★★★★★
Based on 2081 reviews
Sort
Product Reviews
★★★★★ 5
amazing!!
Format: Kindle
Full of twists and turns but an amazing story of love and friendship! A must read if you like a little mystery.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026
★★★★★ 3
Not what I expected at all
Format: Paperback
Hmmm. So this is a good book. But I’m mad b/c I feel betrayed. The back of the book says it’s about Dannie, and how the night she gets engaged to her longtime boyfriend David, she falls asleep. And then she wakes up and spends one hour 5 years in the future. A different apartment, a different ring, a different man. “It’s a love story, but it is not the one you’re expecting”.
Ok, so spoiler alert. If you’re planning to read the book, maybe you shouldn’t read this review and should just read the book as it’s meant to be read. But I would have liked a warning. This is a story about friendship. Dannie and Bella have been best friends since they were 7. While Dannie is conservative and loves to plan, Bohemian Bella flies by the seat of her pants and goes where the wind takes her. They are so different, but are twin souls. And I think the story of their friendship would have been enough. But instead, I was told it was a love story about a woman and two potential men. And I was definitely not warned that this would be a crying book, but the last 20 pages had me just over misty.
Overall, this was not the book I thought I’d be reading. And while it was good, I feel like I’ve been tricked and I’m mad about it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 24, 2025
★★★★★ 4
well written
Format: Kindle
I enjoyed reading this story. It kept my attention and I read the book in a couple of days. The end was a bit unexpected, which is a good thing. The story itself was a little slow at times and I didn’t feel that drawn to the characters. I also wish I had known that it would be a bit sad.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 3, 2026
★★★★★ 5
Great Book!
Format: Paperback
I am not a big reader (but I wish I was! Too restless) so when a friend suggested this book to me, I wasnt sure I'd be able to start (or finish it) to my surprise, I loved it and finished it in a weekend. Now I am on to her other books! Great read! (Even for us non readers) :)
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 21, 2026
★★★★★ 5
finished in one day
Format: Kindle
Wow this book pulls at the heart strings for sure!!! I loved this I couldn’t put it down, finished it In one day
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026