SKU: 24015042741

Human NY-BR-1, His tag

Sale price$90.00 Regular price$100.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 12 - Jul 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human NY-BR-1, His tagProduct Specification Species Human Synonyms ANKRD30A Accession Q9BXX3 Amino Acid Sequence Protein sequence(Q9BXX3, Arg851 Leu928, with C 10*His) RMKVSIPTKALELMDMQTFKAEPPEKPSAFEPAIEMQKSVPNKALELKNEQTLRADQMFPSESKQKKVEENSWDSESLGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 10. 6kDa Actual: 13 20kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer Lyophilized from a 0. 2 m

Product Specification


Species Human
Synonyms ANKRD30A
Accession Q9BXX3
Amino Acid Sequence Protein sequence(Q9BXX3, Arg851-Leu928, with C-10*His) RMKVSIPTKALELMDMQTFKAEPPEKPSAFEPAIEMQKSVPNKALELKNEQTLRADQMFPSESKQKKVEENSWDSESLGGGGSHHHHHHHHHH
Expression System HEK293
Molecular Weight Theoretical:10.6kDa Actual:13-20kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

ANKRD30A has been previously identified as NY-BR-1 or antigen B726P. It was identified based on spontaneous humoural immune responses in breast cancer patients (Jäger et al. 2001, 2002). The protein is regarded as a putative transcription factor, as it contains a bipartite nuclear localization signal motif and a bZIP site (DNA-binding site followed by leucine zipper motif). Additional structural features include five tandem ankyrin repeats, implying a role for ANKRD30A in protein–protein interactions. In view of its highly restricted expression pattern, ANKRD30A may be considered as a breast differentiation antigen that could represent a suitable target for immunotherapy. Indeed, it was found in 80% of breast cancer specimens, while tumours of other histological types were ANKRD30A-negative. It was also identified in normal breast, normal testis, was inconsistent in prostate, and not found in other tissues.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 24015042741

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 2081 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Jacob Johnson
West Palm Beach, US
★★★★★ 5
amazing!!
Format: Kindle
Full of twists and turns but an amazing story of love and friendship! A must read if you like a little mystery.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026
J
Verified Purchase
jesica love
Dallas, US
★★★★★ 3
Not what I expected at all
Format: Paperback
Hmmm. So this is a good book. But I’m mad b/c I feel betrayed. The back of the book says it’s about Dannie, and how the night she gets engaged to her longtime boyfriend David, she falls asleep. And then she wakes up and spends one hour 5 years in the future. A different apartment, a different ring, a different man. “It’s a love story, but it is not the one you’re expecting”. Ok, so spoiler alert. If you’re planning to read the book, maybe you shouldn’t read this review and should just read the book as it’s meant to be read. But I would have liked a warning. This is a story about friendship. Dannie and Bella have been best friends since they were 7. While Dannie is conservative and loves to plan, Bohemian Bella flies by the seat of her pants and goes where the wind takes her. They are so different, but are twin souls. And I think the story of their friendship would have been enough. But instead, I was told it was a love story about a woman and two potential men. And I was definitely not warned that this would be a crying book, but the last 20 pages had me just over misty. Overall, this was not the book I thought I’d be reading. And while it was good, I feel like I’ve been tricked and I’m mad about it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 24, 2025
A
Verified Purchase
Amazon Addict
Lowell, US
★★★★★ 4
well written
Format: Kindle
I enjoyed reading this story. It kept my attention and I read the book in a couple of days. The end was a bit unexpected, which is a good thing. The story itself was a little slow at times and I didn’t feel that drawn to the characters. I also wish I had known that it would be a bit sad.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 3, 2026
L
Verified Purchase
Lesliereneea
Draper, US
★★★★★ 5
Great Book!
Format: Paperback
I am not a big reader (but I wish I was! Too restless) so when a friend suggested this book to me, I wasnt sure I'd be able to start (or finish it) to my surprise, I loved it and finished it in a weekend. Now I am on to her other books! Great read! (Even for us non readers) :)
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 21, 2026
S
Verified Purchase
Sam bennish
Pawtucket, US
★★★★★ 5
finished in one day
Format: Kindle
Wow this book pulls at the heart strings for sure!!! I loved this I couldn’t put it down, finished it In one day
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026

recommand products