SKU: 46503601985

Human pro-GRP, His Tag

Sale price$166.50 Regular price$185.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 12 - Jul 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human pro-GRP, His TagProduct Specification Species Human Accession P07492 Amino Acid Sequence Protein sequence(P07492, Ser54 Asp121 with C 10*His) STGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKDGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 9. 4kDa Actual: 13kDa Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Reconstitution Reconstitute no more than 0. 1 mg mL

Product Specification


Species Human
Accession P07492
Amino Acid Sequence

Protein sequence(P07492, Ser54-Asp121 with C-10*His)


STGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKDGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 9.4kDa Actual: 13kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 0.1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

Pro-Gastrin-Releasing-Peptide, also known as Pro-GRP, is a Gastrin-Releasing-Peptide (GRP) precursor, a neurotransmitter that belongs to the bombesine/neuromedin B family. GRP stimulates the secretion of gastrin in order to increase the acidity of the gastric acid. Pro-GRP is a peptide composed of 125 amino acids, expressed in the nervous system and digestive tract. In pathological situations, GRP has mitogenic activity in vitro in many tumors such as pancreatic, small cell lung (SCLC), prostate, kidney, breast and colorectal cancers. GRP could operate as an autocrine growth factor. In cancers, GRP induces cell growth and inhibits apoptosis by shutting down the endoplasmic reticulum stress pathway. As early as 1994, research on Pro-GRP as a biomarker for small cell lung cancer began. Because of the very short half-life of GRP (2 minutes), the Pro-GRP is used for measurements and analysis. Since then, Pro-GRP has been used as a tumor marker for patients with small cell lung cancer (SCLC) in limited and extended stages.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 46503601985

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 877 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
ALC NJ
Massapequa, US
★★★★★ 5
Dependable sun protection for active days outdoors
Size: 6 Ounce (Pack of 1)
I like how this sunscreen provides reliable broad-spectrum protection and holds up well during outdoor activities. The zinc oxide formula gives me peace of mind, and I appreciate that it's water resistant and reef-safe. It applies smoothly for a mineral sunscreen and stays on effectively during sports, swimming, and long days in the sun. Overall, it's a trustworthy option for anyone looking for strong sun protection.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 8, 2026
J
Verified Purchase
Judy Perez
Louisville, US
★★★★★ 4
Clean product
Size: 3 Ounce (Pack of 1)
I only gave it 4 stars because of the smell. Of course it’s sunscreen so it’s going to have a chemical smell but this smell is just too strong for me. Other then that, it’s a great sunscreen. Does take some more rubbing in and be carful to rub it in really good or you’ll have white streaks all over your face. Leaves a bit of a white cast. You don’t need much.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 12, 2026
I
Verified Purchase
Isabel
Bozeman, US
★★★★★ 5
Great quality
Size: 6 Ounce (Pack of 1)
Thinksport SPF 50+ Mineral Sunscreen with Zinc is a reliable, high‑protection option that feels lightweight and non‑greasy on the skin. It applies smoothly without leaving too much white cast for everyday use, and I love that it’s mineral‑based with zinc for strong UVA/UVB defense. Great for active days outdoors. Highly recommend for sensitive skin and safe sun coverage!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 24, 2026
K
Verified Purchase
K
Los Angeles, US
★★★★★ 5
Brown skin approved!
Size: 6 Ounce (Pack of 1), Size: 6 Ounce (Pack of 1)
Does not leave a white cast, feels very light on the skin. Scanned on Yuka and was a 86/100 green zone! It’s so hard to find a sunscreen that isn’t trying to poison you, scanned all the sunscreen at Walmart and were rated a 1/100 through 6/100. Which brought me to Amazon. Thinksport has my vote on goodness and healthiness, would buy again!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
M
Verified Purchase
MK
Port Orchard, US
★★★★★ 5
My favorite... And I'm picky.
Size: 3 Ounce (Pack of 1)
I've become a little obsessed with sunscreen over the last past 5 years. I have olive skin and developed melasma after my first pregnancy. I learned the hard way that chemical sunscreens don't help if you have melasma - and they actually make the dark spots even worse. Also the active ingredients in chemical sunscreens (like Oxybenzone and Octinoxate) are absorbed by your skin, and may cause allergies, hormonal imbalance and be toxic overtime. After learning that, I started wearing only mineral sunscreen (active ingredient is zinc and/or titanium dioxide). These are not absorbed and works by creating a physical barrier that reflects the sun (some studies suggest that some nanoparticles of zinc may be absorbed by your skin, so to be really, really safe you should look for non-nano particles). After trying a few brands, I realized the sunscreens with only zinc in their formulas worked better than the blends with titanium dioxide, but this is just my personal preference I guess. And the higher the percentage of zinc, the better. Most pure mineral sunscreens out there are 10-ish % zinc, SPF 30, 40 min water resistant - which is ok. Thinksport goes beyond that: It's 20% non-nano zinc, SPF 50+, 80 min water resistant. It really can't get any better than that! The lotion is not extremely thick when compared to other sunscreens I've tried and I find it pretty easy to apply. As every zinc sunscreen, it does leave a little fine white cast, but honestly Thinksport is not bad at all! It smells nice, lightly citrusy - and the smell vanishes soon. And, it's not overpriced. Best I've tried so far.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 15, 2016

recommand products