VHL His&AVI Tag Protein, Human
SKU: 90384198176

VHL His&AVI Tag Protein, Human

Sale price$468.00 Regular price$520.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 9 - Jul 14

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

VHL His&AVI Tag Protein, HumanProduct Specification Species Human Synonyms HRCA1 Protein, Human; pVHL Protein, Human; RCA1 Protein, Human; VHL1 Protein, Human Amino Acid Sequence Met1 Asp213, with N terminal His SUMO & C terminal AVI Tag

Product Specification


Species Human
Synonyms HRCA1 Protein, Human; pVHL Protein, Human; RCA1 Protein, Human; VHL1 Protein, Human
Amino Acid Sequence

Met1-Asp213, with N-terminal His SUMO & C-terminal AVI Tag

MGSSHHHHHHSSGLVPRGSHMASMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGMPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGDGLNDIFEAQKIEWHE

Expression System E.coli
Molecular Weight 45 kDa
Purity

>85% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag Avi Tag, His Tag
Physical Appearance Liquid
Storage Buffer 20 mM PB,100 mM KCl,0.1 mM EDTA ,2 mM DTT, pH 7.5
Reconstitution A hardcopy of datasheet with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 90384198176

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 385 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Katie B
Lexington, US
★★★★★ 5
The ultimate "wake-up" scent (and no dry skin!)
Scent: Citrus + Eucalyptus, Size: 12.2 Fl Oz (Pack of 1)
I’ve tried plenty of "invigorating" body washes, but most of them just smell like artificial lime or leave my skin feeling tight. This Huron Body Wash is in a completely different league. Why it’s my new daily go-to: Complex, Fresh Scent: The mix of citrus, eucalyptus, and mint is incredible. It’s crisp and bold enough to wake you up in the morning, but the aromatic greens give it a sophisticated, high-end finish that doesn't smell like a cheap drugstore brand. Actually Moisturizing: Usually, "cleansing" washes strip your skin, but the coconut oil and Vitamin E in this actually leave my skin feeling smooth. I’ve noticed way less dryness on my elbows and shoulders since switching. Great Lather: A little goes a long way. It creates a rich, creamy lather that feels premium and rinses off clean without any slimy residue. The "Peace of Mind" Factor: It’s hard to find a performance-focused body wash that is also vegan and cruelty-free. Knowing I'm getting a professional-grade product without the harsh chemicals (and with Witch Hazel to keep my skin clear) makes the price totally worth it. Bottom Line: If you want to start your day smelling like a high-end spa rather than a locker room, get this. It’s worth every penny!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 12, 2026
G
Verified Purchase
Greg
Whiting, US
★★★★★ 5
Great product that seems to last a good long time
Scent: Citrus + Eucalyptus, Size: 12.2 Fl Oz (Pack of 2)
This has a subtly pleasant smell. I like it. I like the consistency too. I will order again. It's soft on my skin and super easy to use. I like the bottle size. It's not too big and it's not too small.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 24, 2026
S
Verified Purchase
SD
Charlottesville, US
★★★★★ 4
Smells Amazing, Premium Price
Scent: Sea Salt, Size: 11.3 Fl Oz (Pack of 1)
Great body wash overall. It smells really good clean, fresh, and not overpowering. It lathers well and leaves my skin feeling clean without drying it out. The only downside is that it’s a bit pricey compared to other options, but the quality and scent definitely make it worth considering.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 20, 2026
C
Verified Purchase
Craig & Laurie F.
Carnegie, US
★★★★★ 5
Love this stuff
Scent: Citrus + Eucalyptus, Size: 30.3 Fl Oz (Pack of 1)
Works great and love them scent.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2026
T
Verified Purchase
Terry W
Alexandria, US
★★★★★ 5
One of the best bodywashes I've ever tried!
Scent: Sea Salt, Size: 11.3 Fl Oz (Pack of 1)
Huron Body Wash is one of the best I've ever used. Great scents, and leaves your skin smelling and feeling great. The deodorant is a really great compliment to the body wash. Feel good all day!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 24, 2026

recommand products